<?xml version="1.0" encoding="UTF-8" standalone="no"?>
<!DOCTYPE article PUBLIC "-//NLM//DTD Journal Publishing DTD v2.3 20070202//EN" "journalpublishing.dtd">
<article xmlns:mml="http://www.w3.org/1998/Math/MathML" xmlns:xlink="http://www.w3.org/1999/xlink" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" article-type="research-article" dtd-version="2.3" xml:lang="EN">
<front>
<journal-meta>
<journal-id journal-id-type="publisher-id">Front. Parasitol.</journal-id>
<journal-title>Frontiers in Parasitology</journal-title>
<abbrev-journal-title abbrev-type="pubmed">Front. Parasitol.</abbrev-journal-title>
<issn pub-type="epub">2813-2424</issn>
<publisher>
<publisher-name>Frontiers Media S.A.</publisher-name>
</publisher>
</journal-meta>
<article-meta>
<article-id pub-id-type="doi">10.3389/fpara.2024.1356601</article-id>
<article-categories>
<subj-group subj-group-type="heading">
<subject>Parasitology</subject>
<subj-group>
<subject>Original Research</subject>
</subj-group>
</subj-group>
</article-categories>
<title-group>
<article-title>EhVps35, a retromer component, is involved in the recycling of the EhADH and Gal/GalNac virulent proteins of <italic>Entamoeba histolytica</italic>
</article-title>
</title-group>
<contrib-group>
<contrib contrib-type="author">
<name>
<surname>D&#xed;az-Valdez</surname>
<given-names>Joselin</given-names>
</name>
<xref ref-type="aff" rid="aff1">
<sup>1</sup>
</xref>
<uri xlink:href="https://loop.frontiersin.org/people/2620637"/>
<role content-type="https://credit.niso.org/contributor-roles/conceptualization/"/>
<role content-type="https://credit.niso.org/contributor-roles/writing-original-draft/"/>
<role content-type="https://credit.niso.org/contributor-roles/investigation/"/>
<role content-type="https://credit.niso.org/contributor-roles/methodology/"/>
</contrib>
<contrib contrib-type="author">
<name>
<surname>Javier-Reyna</surname>
<given-names>Rosario</given-names>
</name>
<xref ref-type="aff" rid="aff1">
<sup>1</sup>
</xref>
<uri xlink:href="https://loop.frontiersin.org/people/1467314"/>
<role content-type="https://credit.niso.org/contributor-roles/supervision/"/>
<role content-type="https://credit.niso.org/contributor-roles/writing-original-draft/"/>
<role content-type="https://credit.niso.org/contributor-roles/methodology/"/>
</contrib>
<contrib contrib-type="author">
<name>
<surname>Monta&#xf1;o</surname>
<given-names>Sarita</given-names>
</name>
<xref ref-type="aff" rid="aff2">
<sup>2</sup>
</xref>
<uri xlink:href="https://loop.frontiersin.org/people/734287"/>
<role content-type="https://credit.niso.org/contributor-roles/writing-original-draft/"/>
<role content-type="https://credit.niso.org/contributor-roles/methodology/"/>
<role content-type="https://credit.niso.org/contributor-roles/software/"/>
</contrib>
<contrib contrib-type="author">
<name>
<surname>Talam&#xe1;s-Lara</surname>
<given-names>Daniel</given-names>
</name>
<xref ref-type="aff" rid="aff3">
<sup>3</sup>
</xref>
<role content-type="https://credit.niso.org/contributor-roles/writing-original-draft/"/>
<role content-type="https://credit.niso.org/contributor-roles/methodology/"/>
</contrib>
<contrib contrib-type="author" corresp="yes">
<name>
<surname>Orozco</surname>
<given-names>Esther</given-names>
</name>
<xref ref-type="aff" rid="aff1">
<sup>1</sup>
</xref>
<xref ref-type="author-notes" rid="fn001">
<sup>*</sup>
</xref>
<uri xlink:href="https://loop.frontiersin.org/people/363223"/>
<role content-type="https://credit.niso.org/contributor-roles/conceptualization/"/>
<role content-type="https://credit.niso.org/contributor-roles/funding-acquisition/"/>
<role content-type="https://credit.niso.org/contributor-roles/supervision/"/>
<role content-type="https://credit.niso.org/contributor-roles/writing-original-draft/"/>
<role content-type="https://credit.niso.org/contributor-roles/writing-review-editing/"/>
</contrib>
</contrib-group>
<aff id="aff1">
<sup>1</sup>
<institution>Departamento de Infect&#xf3;mica y Patog&#xe9;nesis Molecular, Centro de Investigaci&#xf3;n y de Estudios Avanzados del Instituto Polit&#xe9;cnico Nacional [CINVESTAV-Instituto Polit&#xe9;cnico Nacional (IPN)]</institution>, <addr-line>Mexico City</addr-line>, <country>Mexico</country>
</aff>
<aff id="aff2">
<sup>2</sup>
<institution>Laboratorio de Bioinform&#xe1;tica y Simulaci&#xf3;n Molecular, Facultad de Ciencias Qu&#xed;mico-Bil&#xf3;gicas, Universidad Aut&#xf3;noma de Sinaloa</institution>, <addr-line>Sinaloa</addr-line>, <country>Mexico</country>
</aff>
<aff id="aff3">
<sup>3</sup>
<institution>Unidad de Microscop&#xed;a Electr&#xf3;nica, Laboratorios Nacionales de Servicios Experimentales (LaNSE), Centro de Investigaci&#xf3;n y de Estudios Avanzados del Instituto Polit&#xe9;cnico Nacional [CINVESTAV-Instituto Polit&#xe9;cnico Nacional (IPN)]</institution>, <addr-line>Mexico City</addr-line>, <country>Mexico</country>
</aff>
<author-notes>
<fn fn-type="edited-by">
<p>Edited by: Abhishek Jamwal, University of Oxford, United Kingdom</p>
</fn>
<fn fn-type="edited-by">
<p>Reviewed by: Tahir Hussain, Iowa State University, United States</p>
<p>Pragyan Parimita Rath, Jawaharlal Nehru University, India</p>
</fn>
<fn fn-type="corresp" id="fn001">
<p>*Correspondence: Esther Orozco, <email xlink:href="mailto:esther@cinvestav.mx">esther@cinvestav.mx</email>
</p>
</fn>
</author-notes>
<pub-date pub-type="epub">
<day>26</day>
<month>03</month>
<year>2024</year>
</pub-date>
<pub-date pub-type="collection">
<year>2024</year>
</pub-date>
<volume>3</volume>
<elocation-id>1356601</elocation-id>
<history>
<date date-type="received">
<day>15</day>
<month>12</month>
<year>2023</year>
</date>
<date date-type="accepted">
<day>01</day>
<month>03</month>
<year>2024</year>
</date>
</history>
<permissions>
<copyright-statement>Copyright &#xa9; 2024 D&#xed;az-Valdez, Javier-Reyna, Monta&#xf1;o, Talam&#xe1;s-Lara and Orozco</copyright-statement>
<copyright-year>2024</copyright-year>
<copyright-holder>D&#xed;az-Valdez, Javier-Reyna, Monta&#xf1;o, Talam&#xe1;s-Lara and Orozco</copyright-holder>
<license xlink:href="http://creativecommons.org/licenses/by/4.0/">
<p>This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.</p>
</license>
</permissions>
<abstract>
<p>The retromer is a highly conserved eukaryotic complex formed by the cargo selective complex (CSC) and the sorting nexin (SNX) dimer subcomplexes. Its function is protein recycling and recovery from the endosomes to conduct the target molecules to the trans-Golgi network or the plasma membrane. The protozoan responsible for human amoebiasis, <italic>Entamoeba histolytica</italic>, exhibits an active membrane movement and voracious phagocytosis, events in which the retromer may be fully involved. In this work, we studied the structure of EhVps35 the central member of the CSC retromeric subcomplex as it binds EhVps26 and EhVps29, the other two CSC members, allowing the position of the retromer in the membranes. We also studied the EhVps35 role in the recycling of virulence proteins, particularly those involved in phagocytosis. Confocal microscopy assays revealed that EhVps35 is located in the plasmatic and endosomal membranes and in the phagocytic cups and channels. In addition, it follows the target cell from the moment it is in contact with the trophozoites. Molecular docking analyses, immunoprecipitation assays, and microscopy studies revealed that EhVps35 interacts with the EhADH, Gal/GalNac lectin, and actin proteins. In addition, experimental evidence indicated that it recycles surface proteins, particularly EhADH and Gal/GalNac proteins, two molecules highly involved in virulence. Knockdown of the <italic>Ehvps35</italic> gene induced a decrease in protein recycling, as well as impairments in the efficiency of adhesion and the rate of phagocytosis. The actin cytoskeleton was deeply affected by the <italic>Ehvps35</italic> gene knockdown. In summary, our results revealed the participation of <italic>EhVps35</italic> in protein recycling and phagocytosis. Furthermore, altogether, our results demonstrated the concert of finely regulated molecules, including EhVps35, EhADH, Gal/GalNac lectin, and actin, in the phagocytosis of <italic>E. histolytica</italic>.</p>
</abstract>
<kwd-group>
<kwd>retromer</kwd>
<kwd>EhVps35</kwd>
<kwd>
<italic>Entamoeba histolytica</italic>
</kwd>
<kwd>EhADH (ALIX family)</kwd>
<kwd>Gal/GalNac lectin</kwd>
<kwd>actin cytoskeleton</kwd>
<kwd>phagocytosis</kwd>
<kwd>recycling</kwd>
</kwd-group>
<counts>
<fig-count count="12"/>
<table-count count="1"/>
<equation-count count="0"/>
<ref-count count="76"/>
<page-count count="20"/>
<word-count count="10158"/>
</counts>
<custom-meta-wrap>
<custom-meta>
<meta-name>section-in-acceptance</meta-name>
<meta-value>Molecular Cellular Parasitology</meta-value>
</custom-meta>
</custom-meta-wrap>
</article-meta>
</front>
<body>
<sec id="s1" sec-type="intro">
<label>1</label>
<title>Introduction</title>
<p>The eukaryotic canonical retromer is a cellular structure strongly involved in the endocytic&#x2013;selecting&#x2013;recycling pathway. In general, it is composed of five proteins that form two subcomplexes: the cargo selective complex (CSC) shaped by Vps26, Vps29, and Vps35 proteins and the SNX-BAR dimer (Vps5 and Vps17 in yeast) that tubulates the endosomal membrane. However, currently, novel functions for retromer proteins continue to be discovered (<xref ref-type="bibr" rid="B5">Bonifacino and Hurley, 2008</xref>; <xref ref-type="bibr" rid="B67">Tomavo et&#xa0;al., 2013</xref>; <xref ref-type="bibr" rid="B61">Sangar&#xe9; et&#xa0;al., 2016</xref>; <xref ref-type="bibr" rid="B47">McNally et&#xa0;al., 2017</xref>; <xref ref-type="bibr" rid="B22">Gras et&#xa0;al., 2019</xref>; <xref ref-type="bibr" rid="B29">Huang et&#xa0;al., 2022</xref>). In humans, for example, the decreased retromer function has been implicated in neurodegenerative processes, causing Parkinson&#x2019;s and Alzheimer&#x2019;s disease (<xref ref-type="bibr" rid="B74">Zhang et&#xa0;al., 2018</xref>).</p>
<p>The Vps35 protein is considered as the retromer central component because it interacts with the other two CSC retromeric components and with proteins such as Rab7 (Ypt7 in yeast) that stabilizes the structure in the endosomal membrane (<xref ref-type="bibr" rid="B62">Seaman et&#xa0;al., 2009</xref>; <xref ref-type="bibr" rid="B39">Liu et&#xa0;al., 2012</xref>; <xref ref-type="bibr" rid="B57">Purushothaman et&#xa0;al., 2017</xref>). It is known that Vps35 participates in the retrograde transport from the endosome to the plasma membrane or the <italic>trans</italic>-Golgi network (TGN), recognizing the cargo proteins for recycling (<xref ref-type="bibr" rid="B5">Bonifacino and Hurley, 2008</xref>; <xref ref-type="bibr" rid="B74">Zhang et&#xa0;al., 2018</xref>). Silencing of the <italic>vps35</italic> gene inhibits signaling of the mitogen-activated protein kinase and the growth of melanoma cells (<xref ref-type="bibr" rid="B76">Zhou et&#xa0;al., 2016</xref>). Based on these findings, Vps35 has been proposed as a putative target for anticancer drugs (<xref ref-type="bibr" rid="B76">Zhou et&#xa0;al., 2016</xref>). Knockout of the <italic>vps35</italic> gene causes ultrastructural and functional alterations in lysosomes, leading to impaired autophagy (<xref ref-type="bibr" rid="B9">Cui et&#xa0;al., 2019</xref>). The accumulation of pathogenic proteins due to a dysfunctional Vps35 accounts for other physiological disorders (<xref ref-type="bibr" rid="B69">Wang and Bellen, 2015</xref>; <xref ref-type="bibr" rid="B74">Zhang et&#xa0;al., 2018</xref>; <xref ref-type="bibr" rid="B9">Cui et&#xa0;al., 2019</xref>; <xref ref-type="bibr" rid="B29">Huang et&#xa0;al., 2022</xref>).</p>
<p>In protozoa, the retromer complex has been poorly studied, although it is known that it differs from the canonical structure that was first described in yeast and then later in mammals (<xref ref-type="bibr" rid="B35">Koumandou et&#xa0;al., 2011</xref>). Future investigations on this cellular complex are necessary to yield additional insights into the mechanisms that could be involved in the virulence processes in protozoa. In <italic>Toxoplasma gondii</italic>, a parasite lacking SNX-BAR proteins, the retromer participates in the formation of rhoptry and microneme secretory organelles, which are necessary for intracellular invasion (<xref ref-type="bibr" rid="B67">Tomavo et&#xa0;al., 2013</xref>; <xref ref-type="bibr" rid="B22">Gras et&#xa0;al., 2019</xref>). In <italic>Entamoeba histolytica</italic>, the protozoan responsible for human amoebiasis, the retromer is composed of the EhVps26, EhVps29, EhVps35, and EhSNX1 proteins (<xref ref-type="bibr" rid="B51">Nakada-Tsukui et&#xa0;al., 2005</xref>; <xref ref-type="bibr" rid="B70">Watanabe et&#xa0;al., 2020</xref>). <italic>E. histolytica</italic> trophozoites incessantly remodel their membrane during movement, phagocytosis, tissue invasion, and vesicular trafficking; thus, it is logical to assume that its non-canonical retromer is functional and probably participates in virulence processes.</p>
<p>In <italic>E. histolytica</italic>, the EhVps26, EhVps29, and EhVps35 proteins have been detected in phagosomes (<xref ref-type="bibr" rid="B42">Marion et&#xa0;al., 2005</xref>; <xref ref-type="bibr" rid="B51">Nakada-Tsukui et&#xa0;al., 2005</xref>; <xref ref-type="bibr" rid="B64">Srivastava et&#xa0;al., 2017</xref>; <xref ref-type="bibr" rid="B70">Watanabe et&#xa0;al., 2020</xref>). In addition, live and immunofluorescence images showed that EhSNX1 and EhVps26 were recruited to the trogocytic cups and tunnel-like structures (<xref ref-type="bibr" rid="B70">Watanabe et&#xa0;al., 2020</xref>), suggesting a role of the retromer in target cell ingestion. However, further studies are necessary to clarify the mechanisms that make possible or are required to elucidate the role that each retromer member plays in the full complex.</p>
<p>The aim of this work was to investigate the structure of EhVps35 and its functional role in the recycling of EhADH (a protein belonging to the ALIX family) and the Gal/GalNac lectin, which are both involved in target cell adhesion and in the phagocytic process. Our <italic>in silico</italic> analysis revealed that EhVps35 is a <italic>bona fide</italic> ortholog of the Vps35 proteins described in other eukaryotic systems. In addition, our experimental results using a trophozoite population with the <italic>Ehvps35</italic> gene knocked down showed that this protein participates in plasma membrane protein recycling. Remarkably, we present here evidence that the EhADH protein and Gal/GalNac lectin are recycled by EhVps35. In addition, we found that this protein has an important role in the actin cytoskeleton structuring, which makes it a fundamental player in phagocytosis.</p>
</sec>
<sec id="s2" sec-type="materials|methods">
<label>2</label>
<title>Materials and methods</title>
<sec id="s2_1">
<label>2.1</label>
<title>
<italic>In silico</italic> analysis of EhVps35</title>
<p>
<italic>Homo sapiens</italic> and <italic>Saccharomyces cerevisiae</italic> Vps35 protein sequences (access Q96QK1 and P34110, respectively), retrieved from the UniProt database (<ext-link ext-link-type="uri" xlink:href="https://www.uniprot.org">https://www.uniprot.org</ext-link>), were used as query to search the <italic>E. histolytica</italic> Vps35 proteins (EhVps35) in the AmoebaDB database (<ext-link ext-link-type="uri" xlink:href="https://amoebadb.org/amoeba/app">https://amoebadb.org/amoeba/app</ext-link>). The structural domains of the candidates were identified using the SMART genomics server (<ext-link ext-link-type="uri" xlink:href="http://smart.embl-heidelberg.de/">http://smart.embl-heidelberg.de/</ext-link>) and the KEGG server (<ext-link ext-link-type="uri" xlink:href="https://www.genome.jp/kegg/">https://www.genome.jp/kegg/</ext-link>). The predicted amino acid sequences of the five <italic>E. histolytica</italic> putative EhVps35 proteins (access C4M8Z4, C4M4G0, A0A8U0WP17, C4LWG4, and C4M3E8) were aligned with the orthologous sequences of <italic>H. sapiens</italic> (access Q96QK1), <italic>S. cerevisiae</italic> (access P34110), <italic>Arabidopsis thaliana</italic> (access Q7X659, F4I0P8, and A8R7K9), <italic>Plasmodium falciparum</italic> (access Q8IIQ6), <italic>T. gondii</italic> (access S7USD8), <italic>Trypanosoma brucei</italic> (access Q38C17), and <italic>Giardia lamblia</italic> (access Q6Y0Y2).</p>
</sec>
<sec id="s2_2">
<label>2.2</label>
<title>Plasmid constructs</title>
<p>The complementary DNA (cDNA) was obtained as described (<xref ref-type="bibr" rid="B18">Galindo et&#xa0;al., 2021</xref>). The <italic>Ehvps35<sub>1&#x2013;1,428 bp</sub>
</italic> and <italic>Ehvps35<sub>1&#x2013;543 bp</sub>
</italic> DNA fragments were PCR-amplified using cDNA as template and specific primers.</p>
<list list-type="order">
<list-item>
<p>For <italic>Ehvps35<sub>1&#x2013;1,225 bp</sub>
</italic>: sense: 5&#x2032;-CC<underline>GGTACC</underline>ATGAGTCGTCCACAACGAGA-3&#x2032;; antisense: 5&#x2032;-GG<underline>GGATCC</underline>TTT TATATCATCTGGTTGATCTTG-3&#x2032;</p>
</list-item>
<list-item>
<p>For <italic>Ehvps35<sub>1&#x2013;543 bp</sub>
</italic>: sense: 5&#x2032;-CC<underline>GGTACC</underline>ATG AGTCGTCCACAACGAG-3&#x2032;; antisense: 5&#x2032;-GG<underline>GGATCC</underline>TGTTGGATGTTG AACCGCTC-3&#x2032;</p>
</list-item>
</list>
<p>Underlined sequences correspond to the enzyme restriction sites added to the primers. Fragments were cloned in <italic>pColdI</italic> to produce recombinant proteins tagged with 6&#xd7; His and in <italic>pL4440</italic> for the silencing experiments. Thus, we generated the <italic>pColdI/Ehvps35<sub>1&#x2013;1,225 bp</sub>
</italic> and <italic>pL4440/Ehvps35</italic> plasmids, respectively. The quality of the constructs was verified by restriction enzyme analysis and automatic DNA sequencing.</p>
</sec>
<sec id="s2_3">
<label>2.3</label>
<title>Expression of the His-Eh Vps35 recombinant protein</title>
<p>
<italic>Escherichia coli</italic> BL21 (DE3) bacteria were transformed with the <italic>pColdI/Ehvps35<sub>1&#x2013;1,225 bp</sub>
</italic> plasmid to produce the His-tagged EhVps35<sub>1&#x2013;476 aa</sub> recombinant protein (rEhVps35). Protein expression was induced by 0.4 mM isopropyl &#x3b2;-<sc>d</sc>-thiogalactopyranoside (IPTG) in Luria&#x2013;Bertani (LB) medium for 16&#xa0;h at 16&#xb0;C. The identity and integrity of the purified rEhVps35 protein were verified by 10% SDS-PAGE and Western blot assays.</p>
</sec>
<sec id="s2_4">
<label>2.4</label>
<title>Antibodies</title>
<p>To generate mouse polyclonal antibodies against a specific EhVps35 peptide (N<sub>30</sub>-ESEIMNAALNNKDLSK-C<sub>45</sub>), male Balb/c mice (from an already existing collection in UPEAL-CINVESTAV) were immunized with 80 &#xb5;g of the peptide resuspended in TiterMax Gold adjuvant (1:1; Sigma-Aldrich, St. Louis, MO, USA). Thereafter, three more immunizations were performed at 15-day intervals, followed by bleeding to generate the &#x3b1;-EhVps35 antibody. Pre-immune serum was obtained before immunizations.</p>
<p>The other primary antibodies used were as follows: mouse monoclonal &#x3b1;-biotin (Santa Cruz, Dallas, TX, USA), hamster &#x3b1;-EhADH (<xref ref-type="bibr" rid="B17">Galindo et&#xa0;al., 2022</xref>), mouse &#x3b1;-heavy subunit Hgl of Gal/GalNac lectin (kindly given by Dr. William A. Petri Jr., University of Virginia, Charlottesville, VA, USA), mouse &#x3b1;-Hist (Santa Cruz), mouse monoclonal &#x3b1;-human actin (kindly given by Dr. Manuel Hernandez, CINVESTAV IPN, Mexico), and rat &#x3b1;-EhVps23 (<xref ref-type="bibr" rid="B18">Galindo et&#xa0;al., 2021</xref>). As secondary antibodies, the following were used: horseradish peroxidase (HRP)-labeled &#x3b1;-hamster, &#x3b1;-rat, and &#x3b1;-mouse immunoglobulin G (IgG) (Zymed, San Francisco, CA, USA) for the Western blot assays and fluorescein isothiocyanate (FITC), Cy5, or the Pacific Blue &#x3b1;-mouse and Alexa 647 &#x3b1;-hamster IgG (Life Technologies, Carlsbad, CA, USA) for the immunofluorescence assays.</p>
</sec>
<sec id="s2_5">
<label>2.5</label>
<title>
<italic>E. histolytica</italic> cultures</title>
<p>
<italic>E. histolytica</italic> trophozoites, strain HM1:IMSS, were axenically grown at 37&#xb0;C in TYI-S-33 medium (<xref ref-type="bibr" rid="B12">Diamond et&#xa0;al., 1978</xref>) and harvested at the logarithmic growth phase. Afterward, the culture flasks were chilled at 4&#xb0;C and the trophozoites collected by centrifugation. All experiments reported here were performed at least three times in duplicate.</p>
</sec>
<sec id="s2_6">
<label>2.6</label>
<title>Western blot experiments</title>
<p>The trophozoite lysates (35 &#xb5;g) were electrophoresed in 10% SDS-PAGE, transferred to nitrocellulose membranes, and probed with either &#x3b1;-EhVps35 (1:500), &#x3b1;-Hist (1:500), &#x3b1;-actin (1:3,000), &#x3b1;-Hgl Gal/GalNac lectin (1:100), &#x3b1;-EhADH (1:500), or &#x3b1;-EhVps23 (1:500) antibodies. The membranes were washed, incubated with the respective HRP-labeled secondary antibodies (1:1,000; Sigma), and revealed using the ECL Prime detection reagent (GE Healthcare, Chicago, IL, USA) according to the manufacturer&#x2019;s instructions.</p>
</sec>
<sec id="s2_7">
<label>2.7</label>
<title>Laser confocal microscopy assays</title>
<p>Trophozoites were grown on coverslips, fixed with 4% paraformaldehyde at 37&#xb0;C for 1&#xa0;h, permeabilized (or not) with 0.2% Triton X-100, and blocked with 10% fetal bovine serum in phosphate-buffered saline (PBS). The preparations were incubated at 4&#xb0;C overnight (ON) with the primary antibodies (1:50). For some experiments, &#x3b1;-EhVps35 labeled with a FITC fluorochrome kit (Molecular Probes/Thermo Fisher, Waltham, MA, USA) was also used. The preparations were incubated with the corresponding secondary antibodies for 30&#xa0;min at 37&#xb0;C: FITC-labeled &#x3b1;-mouse IgG for &#x3b1;-EhVps35, Cy5-labeled &#x3b1;-mouse IgG for &#x3b1;-biotin, Pacific Blue-labeled &#x3b1;-mouse IgG for &#x3b1;-Hgl Gal/GalNac, and Alexa Fluor 647-labeled &#x3b1;-hamster IgG for &#x3b1;-EhADH. The nuclei were labeled with 4&#x2032;,6-diamidino-2-phenylindole (DAPI) for 5&#xa0;min at room temperature (RT), and F-actin was detected by incubation with rhodamine phallodin (Invitrogen, Carlsbad, CA, USA) for 20&#xa0;min at 37&#xb0;C. All preparations were preserved using a VECTASHIELD antifade reagent (Vector, Newark, CA, USA). Subsequently, 0.5-&#xb5;m laser sections were obtained and examined through a Carl Zeiss LMS 700 confocal microscope and then processed with ZEN 2009 Light Edition software (Zeiss, Jena, Germany). To evaluate the co-localization between molecules, Pearson&#x2019;s coefficients were obtained from at least 30 confocal images using ImageJ 1.45v software and the JACoP plug-in.</p>
</sec>
<sec id="s2_8">
<label>2.8</label>
<title>Phagocytosis assays</title>
<p>For the phagocytosis assays, the trophozoites were incubated at 37&#xb0;C for 2, 5, and 30&#xa0;min with red blood cells (RBCs; 1:25) from an already existing collection. At different times, the trophozoites were prepared for immunofluorescence (<xref ref-type="bibr" rid="B20">Garc&#xed;a-Rivera et&#xa0;al., 1982</xref>) and observed through a laser confocal microscope. Other preparations were stained using the Novikoff technique (<xref ref-type="bibr" rid="B52">Novikoff et&#xa0;al., 1972</xref>), and adhered or ingested RBCs were counted through a light microscope (Zeiss Axiolab) in 100 randomly chosen trophozoites. In other experiments (i.e., pulse-chase), the trophozoites were incubated with RBCs for 2&#xa0;min at 37&#xb0;C. Afterward, the cell mixtures were washed with TYI/water (2:1) for 5&#xa0;min at 37&#xb0;C to remove the adhered and non-ingested RBCs. Subsequently, the cells were incubated at 37&#xb0;C for different times (3, 13, 28, 58, or 88&#xa0;min) and processed for Western blot or immunofluorescence assays.</p>
<p>To visualize the acidic structures, the trophozoites were incubated with LysoTracker&#x2122; Blue DND-22 (2 &#x3bc;g/ml; Invitrogen) at 37&#xb0;C for 2&#xa0;h and were then prepared for the immunofluorescence assays as described above. In other cases, to inhibit <italic>de novo</italic> protein synthesis, the trophozoites were incubated for 30&#xa0;min at 37&#xb0;C with cycloheximide (CHX; 100 &#xb5;g/ml), washed with PBS, and then used for the experiments after verifying that the viability was greater than 98%, which was evaluated using trypan blue exclusion (0.2%) and examined under a light microscope (<xref ref-type="bibr" rid="B3">Ba&#xf1;uelos et&#xa0;al., 2012</xref>).</p>
</sec>
<sec id="s2_9">
<label>2.9</label>
<title>Transmission electron microscopy</title>
<p>The trophozoites in basal condition and those incubated for 5&#xa0;min with RBCs (1:25) at 37&#xb0;C were prepared for TEM as described (<xref ref-type="bibr" rid="B66">Talam&#xe1;s-Lara et&#xa0;al., 2021</xref>). Briefly, the trophozoites were fixed with 4% paraformaldehyde and 0.5% glutaraldehyde in PBS for 1&#xa0;h at RT, washed with PBS, and dehydrated with increasing concentrations of ethanol. After infiltration, the samples were embedded in LR White resin (London Resin Co., London, UK) and polymerized under UV at 4&#xb0;C for 48&#xa0;h to obtain thin sections (60 nm), which were mounted on Formvar-coated nickel grids followed by ON incubation at 4&#xb0;C with the &#x3b1;-EhVps35 antibody (1:50). Thereafter, the samples were incubated ON with the corresponding secondary antibodies (1:50) conjugated to 20-nm gold particles (TED Pella Inc., Redding, CA, USA), contrasted with uranyl acetate and lead citrate, and observed through a Joel JEM-1011 transmission electron microscope.</p>
</sec>
<sec id="s2_10">
<label>2.10</label>
<title>dsRNA-based <italic>Ehvps35</italic> gene silencing</title>
<p>The knockdown (KD) of the <italic>Ehvps35</italic> gene was performed using the bacterial expressed double-stranded RNA (dsRNA) that was soaked with the trophozoites as described (<xref ref-type="bibr" rid="B63">Solis et&#xa0;al., 2009</xref>). Briefly, HT115 bacteria were transformed with <italic>pL4440/Ehvps35</italic> and grown at 37&#xb0;C in LB broth in the presence of ampicillin (100 mg/ml) and tetracycline (10 mg/ml) (<xref ref-type="bibr" rid="B65">Takiff et&#xa0;al., 1989</xref>). The expression of <italic>Ehvps35</italic> dsRNA was induced by 1 mM IPTG overnight at 37&#xb0;C. The dsRNA was then isolated from bacteria using a TRIzol reagent (Invitrogen) according to the manufacturer&#x2019;s recommendations. DNase I (Invitrogen) and RNase A (Ambion, Austin, TX, USA) were added to remove the single-stranded RNA (ssRNA) and double-stranded DNA (dsDNA) molecules. The <italic>Ehvps35</italic> dsRNA was washed with isopropanol and ethanol, analyzed using agarose gel electrophoresis, and its concentration determined by spectrophotometry. Finally, the trophozoites (3 &#xd7; 10<sup>4</sup>) in the TYI-S-33 medium were incubated with purified <italic>Ehvps35</italic> dsRNA molecules to a final concentration of 5 &#x3bc;g/ml and the cultures left for 48&#xa0;h at 37&#xb0;C, the time at which we previously determined was the silencing effect. Cells growing under standard conditions (without dsRNA) were used as the control.</p>
</sec>
<sec id="s2_11">
<label>2.11</label>
<title>Recycling of biotinylated surface proteins</title>
<p>For the recycling assays, we followed the protocol described by <xref ref-type="bibr" rid="B31">Ivaska et&#xa0;al. (2002)</xref> and <xref ref-type="bibr" rid="B60">Roberts et&#xa0;al. (2001)</xref>, with some modifications. The trophozoites were incubated for 1&#xa0;h at 37&#xb0;C in serum-free TYI medium and then washed once with cold PBS. The cell surface proteins were labeled with 0.2 mg/ml of EZ-Link&#x2122; sulfo-NHS-SS-cleavable biotin (Thermo Scientific, Waltham, MA, USA) at 4&#xb0;C for 30&#xa0;min (<xref ref-type="bibr" rid="B4">Biller et&#xa0;al., 2014</xref>). After this time, the trophozoites were washed with cold PBS and incubated in TYI complete medium at 37&#xb0;C for 15&#xa0;min to allow internalization of the labeled proteins. To remove labeling from the cell surface proteins, the trophozoites were incubated in 100 mM dithiothreitol (DTT) for 30&#xa0;min at 4&#xb0;C, washed once with cold PBS, incubated again with TYI complete medium for 20 or 40&#xa0;min at 37&#xb0;C, and then observed through a laser confocal microscope.</p>
<p>For analysis of EhADH protein and Gal/GalNac lectin recycling, the protocol described above was followed, omitting the treatment with biotin and DTT and using an incubation step of 40&#xa0;min at 37&#xb0;C to follow the recycling of the proteins. Thereafter, the samples were processed to confocal microscopy using the antibodies and labeled secondary antibodies in order to follow the recycling of EhADH and Gal/GalNac. Moreover, for some experiments, the trophozoites were incubated with CHX (100 &#xb5;g/ml) at 37&#xb0;C for 30&#xa0;min. Lastly, the samples were prepared for laser confocal microscopy and Western blot assays.</p>
</sec>
<sec id="s2_12">
<label>2.12</label>
<title>Three-dimensional model and molecular dynamics simulation of EhVps35</title>
<p>The three-dimensional (3D) model of EhVps35 was obtained on the I-TASSER server using the <italic>Mus musculus</italic> (PDBID:6VAB: B) and <italic>H. sapiens</italic> (PDB:7BLN:C) Vps35 as templates. The 3D model was refined through 200 ns of molecular dynamics stimulation (MDS) by NAMD2.8 (<xref ref-type="bibr" rid="B56">Phillips et&#xa0;al., 2020</xref>) with the force field CHARMM36 to create the topologies of the protein (<xref ref-type="bibr" rid="B28">Huang and Mackerell, 2013</xref>). The TIP3 model was applied for the water molecules. The system was solvated using the psfgen plug-in in the VMD program (<xref ref-type="bibr" rid="B30">Humphrey et&#xa0;al., 1996</xref>). Thereafter, 64,480 water molecules and 12 sodium ions were added to neutralize the system, which was minimized for 10,000 steps, followed by equilibration under constant temperature and pressure (NPT) conditions for 1 ns with the protein and lipid atoms restrained. Afterward, MDS was run for 200 ns, considering EhVps35 as a soluble protein, without position restraints under periodic boundary conditions (PBCs) and using an NPT ensemble at 310&#xa0;K and 200 ns of MD simulation. The structures were visualized using the UCSF Chimera software. Once the best EhVps35 model was chosen, 3D structural alignment with the Vps35 from <italic>H. sapiens</italic> (PDB:7BLN:C) was developed to compare both proteins.</p>
</sec>
<sec id="s2_13">
<label>2.13</label>
<title>Protein&#x2013;protein docking analysis</title>
<p>The published 3D predicted and refined structures (<xref ref-type="bibr" rid="B49">Monta&#xf1;o et&#xa0;al., 2017</xref>) of EhADH were used for docking experiments, whereas the 3D model of the EhVps35 protein was generated in this work. Snapshots were obtained using clustering analysis of the 200-ns MDS with the Carma software (<xref ref-type="bibr" rid="B34">Koukos and Glykos, 2013</xref>). Protein&#x2013;protein docking was performed employing different conformers with the ClusPro server (<xref ref-type="bibr" rid="B8">Comeau et&#xa0;al., 2004</xref>; <xref ref-type="bibr" rid="B36">Kozakov et&#xa0;al., 2013</xref>). The conformers with the highest cluster members and the lowest energy were analyzed on the PDBSum server (<xref ref-type="bibr" rid="B37">Laskowski et&#xa0;al., 1997</xref>), while 3D model visualization was performed by the VMD program (<xref ref-type="bibr" rid="B30">Humphrey et&#xa0;al., 1996</xref>).</p>
</sec>
<sec id="s2_14">
<label>2.14</label>
<title>Immunoprecipitation assays</title>
<p>Immunoprecipitation was carried out using trophozoite lysates prepared in the presence of 10 mM Tris-HCl, 50 mM NaCl, and 100 mM protease inhibitors (i.e., PHMB, IA, NEM, and TLCK), followed by freeze&#x2013;thawing cycles in liquid nitrogen and vortexing (<xref ref-type="bibr" rid="B2">Avalos-Padilla et&#xa0;al., 2015</xref>). In parallel, 200 &#x3bc;l of the recombinant protein G-agarose (rProtein-G; Invitrogen) was incubated with 100 &#x3bc;g of the mouse &#x3b1;EhVp35 antibodies or the pre-immune serum for 2&#xa0;h at 4&#xb0;C, with gentle stirring. Thereafter, the rProtein-G beads were washed with 0.5% bovine serum albumin (BSA) in PBS, followed by additional washes with PBS for 5&#xa0;min, under gentle stirring, and centrifuged at 11,600 &#xd7; <italic>g</italic> for 2&#xa0;min. The trophozoite lysates (1 mg) were pre-cleared with 200 &#x3bc;l of rProtein-G (previously blocked with 2% BSA) and incubated for 2&#xa0;h at 4&#xb0;C under gentle stirring. The samples were then centrifuged at 11,600 &#xd7; <italic>g</italic> to obtain the supernatant that was added to the rProtein-G previously incubated with antibodies. The preparations were incubated ON at 4&#xb0;C and the beads recovered by centrifugation. After washes with PBS, 60 &#x3bc;l of 4&#xd7; sample buffer (40% glycerol, 240 mM Tris-HCl, pH 6.8, 8% SDS, 0.04% bromophenol blue, and 5% &#x3b2;-mercaptoethanol) was added. The samples were boiled for 3&#xa0;min and centrifuged again at 11,600 &#xd7; <italic>g</italic> for 2&#xa0;min at 4&#xb0;C. The supernatant (30 &#x3bc;l) was loaded into 12% SDS-PAGE, subjected to Western blot assays, and revealed using the &#x3b1;-EhVps35, &#x3b1;-EhADH, &#x3b1;-Hgl Gal/GalNac, and &#x3b1;-actin antibodies.</p>
</sec>
<sec id="s2_15">
<label>2.15</label>
<title>Mass spectrometry analysis</title>
<p>Approximately 30 &#x3bc;g of the immunoprecipitated proteins was enzymatically digested according to the protocol reported by <xref ref-type="bibr" rid="B58">Ram&#xed;rez-Flores et&#xa0;al. (2019)</xref>. Afterward, the peptides were loaded into the Symmetry C18 Trap V/M precolumn (Waters, Milford, MA, USA), 180 &#x3bc;m &#xd7; 20&#xa0;mm, 100-&#xc5; pore size, and 5-&#x3bc;m particle size, and desalted using mobile phase A (0.1% formic acid in H<sub>2</sub>O) and mobile phase B (0.1% formic acid in acetonitrile) under the following isocratic gradient: 99.9% mobile phase A and 0.1% mobile phase B at a flow of 5 &#x3bc;l min<sup>&#x2212;1</sup> for 3&#xa0;min. Subsequently, the peptides were loaded and separated on an HSS T3 C18 column (Waters), 75 &#x3bc;m &#xd7; 150&#xa0;mm, 100-&#xc5; pore size, and 1.8-&#x3bc;m particle size, using a UPLC ACQUITY M-Class (Waters) with the same mobile phases under the following gradient: 0&#xa0;min with 7% mobile phase B, 121.49&#xa0;min with 40% mobile phase B, 123&#x2013;126.46 min with 85% mobile phase B, and 129&#x2013;130 min of 7% mobile phase B, at a flow of 400 nl min<sup>&#x2212;1</sup> at 45&#xb0;C. The spectra were acquired with a mass spectrometer using electrospray ionization and ion mobility separation with Synapt G2-Si (Waters) using a data-independent acquisition approach in HDMSE mode (Waters). The generated raw files containing the MS and MS/MS spectra were deconvoluted and compared using the ProteinLynx Global SERVER (PLGS) v3.0.3 software (<xref ref-type="bibr" rid="B38">Li et&#xa0;al., 2009</xref>) against a reversed <italic>E. histolytica</italic> database (downloaded from UniProt). All identifications had a reliability &#x2265;95%.</p>
</sec>
<sec id="s2_16">
<label>2.16</label>
<title>Statistical analysis</title>
<p>The values for all experiments were expressed as the mean and standard error of at least three independent assays carried out in duplicate. Statistical analyses were performed with the GraphPad Prism v5.01 software using paired Student&#x2019;s <italic>t</italic>-test (*<italic>p</italic> &lt; 0.05, **<italic>p</italic> &lt; 0.01, and ***<italic>p</italic> &lt; 0.001).</p>
</sec>
<sec id="s2_17">
<label>2.17</label>
<title>Ethics statement</title>
<p>CINVESTAV fulfills the standard of the Mexican Official Norm (NOM-062-ZOO-1999), &#x201c;Technical Specifications for the Care and Use of Laboratory Animals,&#x201d; based on the Guide for the Care and Use of Laboratory Animals (&#x201c;The Guide,&#x201d; 2011, NRC, USA, with Federal Register no. BOO.02.03.02.01.908) awarded by the National Service for Agrifood Health, Safety and Quality (SENASICA). This organization verifies the state of compliance of such NOM in Mexico and is under the Ministry of Agriculture and Rural Development. The Institutional Committee for Animal Care and Use (IACUC/Ethics Committee) from CINVESTAV, the regulatory office for research protocol approval involving the use of laboratory animals, reviewed and approved all animal experiments (protocol no. 0505-12, CICUAL 001).</p>
</sec>
</sec>
<sec id="s3" sec-type="results">
<label>3</label>
<title>Results</title>
<sec id="s3_1">
<label>3.1</label>
<title>
<italic>E. histolytica</italic> presents a non-canonical retromer</title>
<p>The canonical retromer in yeast and mammals is formed by Vps26, Vps29, Vps35, and SNX dimer (Vps5 and Vps17 in yeast and SNX1, SNX2, SNX5, and SNX6 in mammals). In contrast, only the EhVps26, EhVps29, EhVps35, and EhSNX1 proteins have been identified in <italic>E. histolytica</italic> (<xref ref-type="bibr" rid="B51">Nakada-Tsukui et&#xa0;al., 2005</xref>; <xref ref-type="bibr" rid="B70">Watanabe et&#xa0;al., 2020</xref>). In addition, unlike other SNX orthologs, EhSNX1 presents only the PX and not the BAR domain (<xref ref-type="fig" rid="f1">
<bold>Figure&#xa0;1A</bold>
</xref>). From what is known so far, EhVps26 is the only retromeric protein that binds to EhRab7A (<xref ref-type="fig" rid="f1">
<bold>Figure&#xa0;1A</bold>
</xref>) (<xref ref-type="bibr" rid="B51">Nakada-Tsukui et&#xa0;al., 2005</xref>), in contrast to the retromer of other species where Vps35 also interacts with Rab7 on the endosomal membranes (<xref ref-type="fig" rid="f1">
<bold>Figure&#xa0;1A</bold>
</xref>) (<xref ref-type="bibr" rid="B62">Seaman et&#xa0;al., 2009</xref>; <xref ref-type="bibr" rid="B39">Liu et&#xa0;al., 2012</xref>; <xref ref-type="bibr" rid="B57">Purushothaman et&#xa0;al., 2017</xref>).</p>
<fig id="f1" position="float">
<label>Figure&#xa0;1</label>
<caption>
<p>Comparative representation of the <italic>Entamoeba histolytica</italic> retromer with the human and yeast canonical structures. <bold>(A)</bold> <italic>Upper section</italic> shows the difference between the sorting nexin (SNX) proteins in <italic>Homo sapiens</italic>, <italic>Saccharomyces cerevisiae</italic>, and <italic>E. histolytica</italic>. <italic>Below</italic>: scheme illustrating the retromeric protein structure in these organisms. <bold>(B)</bold> Diagram of the Vps35 protein showing the Vps35 domain (<italic>red box</italic>) covering most of the protein and the PRLYL motif (<italic>green box</italic> in the sequences <italic>below</italic>) at the N-terminus. <italic>Below</italic>: amino acid sequence alignment of the fragment surrounding the PRLYL motif of Vps35 proteins from <italic>H. sapiens</italic> (<italic>Hs</italic>), <italic>S. cerevisiae</italic> (<italic>Sc</italic>), <italic>Arabidopsis thaliana</italic> (<italic>At</italic>), <italic>Plasmodium falciparum</italic> (<italic>Pf</italic>), <italic>Toxoplasma gondii</italic> (<italic>Tg</italic>), <italic>Trypanosoma brucei</italic> (<italic>Tb</italic>), <italic>Giardia lamblia</italic> (<italic>Gl</italic>), and <italic>E. histolytica</italic> (<italic>Eh</italic>). <italic>Dashed lines</italic> show the PRLYL motif marked in <italic>green square</italic> in all sequences. Shadow amino acids in these sequences indicate the identity and homology among the species according to intensity. The <italic>numbers to the left</italic> and <italic>right</italic> correspond to the regions of the alignment for each protein.</p>
</caption>
<graphic mimetype="image" mime-subtype="tiff" xlink:href="fpara-03-1356601-g001.tif"/>
</fig>
<p>In the <italic>E. histolytica</italic> genome, five EhVps35 isoforms (A&#x2013;E) were found, but only two of them (EhVps35A and EhVps35C) were conserved in the complete PRLYL motif (<xref ref-type="fig" rid="f1">
<bold>Figure&#xa0;1B</bold>
</xref>), which allows the binding of Vps26 to Vps35 in yeast and mammalian cells. For this study, EhVps35C was selected as, so far, it is the only <italic>E. histolytica</italic> protein with experimental evidence of direct interaction with EhVps26 and EhVps29 (the other two proteins of the CSC complex) and it is translationally active (<xref ref-type="bibr" rid="B42">Marion et&#xa0;al., 2005</xref>; <xref ref-type="bibr" rid="B51">Nakada-Tsukui et&#xa0;al., 2005</xref>; <xref ref-type="bibr" rid="B4">Biller et&#xa0;al., 2014</xref>; <xref ref-type="bibr" rid="B54">Perdomo et&#xa0;al., 2015</xref>). However, the functionality of the other four EhVps35, found in AmoebaDB, cannot be discarded. In fact, there are reports on a functional Vps35 isoform without the complete PRLYL motif in <italic>A. thaliana</italic> (<xref ref-type="bibr" rid="B32">Jaillais et&#xa0;al., 2007</xref>; <xref ref-type="bibr" rid="B26">Hashiguchi et&#xa0;al., 2012</xref>; <xref ref-type="bibr" rid="B73">Zelazny et&#xa0;al., 2013</xref>).</p>
</sec>
<sec id="s3_2">
<label>3.2</label>
<title>EhVps35 is localized in the plasma membrane and in cytoplasmic vesicles</title>
<p>To study the cellular location and follow the movement of the EhVps35C (hereinafter EhVps35) protein in the trophozoites, we generated specific antibodies against an EhVps35 peptide (N<sub>30</sub>-ESEIMNAALNN KDLSK-C<sub>45</sub>) located at the amino terminal region of the protein and absent in other isoforms (<xref ref-type="fig" rid="f2">
<bold>Figures&#xa0;2A, B</bold>
</xref>). This polypeptide was commercially synthetized and injected into mice to generate antibodies (&#x3b1;-EhVps35). An EhVps35 fragment (1&#x2013;476 amino acids) was also used to obtain the recombinant EhVps35 polypeptide (rEhVps35), labeled with a histidine tag (His-tag). The rEhVps35 was used to verify the specific recognition of the &#x3b1;-EhVps35 antibody in the Western blot assays. The &#x3b1;-Hist and &#x3b1;-EhVps35 antibodies recognized the same 48-kDa band in the lysates obtained from transformed bacteria (<xref ref-type="fig" rid="f2">
<bold>Figure&#xa0;2C</bold>
</xref>). Similarly, the &#x3b1;-EhVps35 antibody recognized a 71-kDa band in the trophozoite lysates (<xref ref-type="fig" rid="f2">
<bold>Figure&#xa0;2C</bold>
</xref>). The expected molecular weight of the EhVps35 protein, calculated from its amino acid sequence, was 87.2 kDa. However, the aberrant migration of EhVps35 was not surprising as this has been widely reported for the Vps35 protein in humans (<xref ref-type="bibr" rid="B24">Haft et&#xa0;al., 2000</xref>; <xref ref-type="bibr" rid="B10">Damen et&#xa0;al., 2006</xref>; <xref ref-type="bibr" rid="B75">Zhao et&#xa0;al., 2007</xref>; <xref ref-type="bibr" rid="B15">Fjorback et&#xa0;al., 2012</xref>) and for other EhVps in <italic>E. histolytica</italic> (<xref ref-type="bibr" rid="B2">Avalos-Padilla et&#xa0;al., 2015</xref>). The aberrant migration behavior could be explained by the protein structure and charge.</p>
<fig id="f2" position="float">
<label>Figure&#xa0;2</label>
<caption>
<p>Cellular location of EhVps35. <bold>(A)</bold> Schematic representation of the amino acid sequence (<italic>red box</italic>) used to generate specific mouse &#x3b1;-EhVps35 antibodies. <bold>(B)</bold> Diagram of the conserved regions in EhVps35 isoforms, indicating in EhVps35C the region used to produce the &#x3b1;-EhVps35 antibodies. <italic>Green box</italic>, DLYELVQYYGNVIPRLYLMITVG; <italic>yellow box</italic>, LKDLIEMCRAVQHPTKGLFLRNYLL DCIK; <italic>blue box</italic>, YKTIILPRILEQVILCRDLVSQEYLMDAIIQAFPDEFHLKT; <italic>red box</italic>, peptide N<sub>30</sub>-ESEIMNAALNNKDLSK-C<sub>45</sub>. <bold>(C)</bold> Coomassie blue-stained gel (10% SDS-PAGE) containing the lysates of non-induced (<italic>NI</italic>) and induced (<italic>I</italic>) bacteria. <italic>Arrows</italic> denote the recombinant EhVps35 (<italic>rEhVps35</italic>). <italic>Right</italic>: Western blot assays of the NI and I transformed bacteria detected with the &#x3b1;-Hist and &#x3b1;-EhVps35 antibodies. Western blot assays of the lysates of trophozoites were developed with &#x3b1;-EhVps35 antibodies. <italic>Arrow</italic> denotes the EhVps35 protein. <italic>PS</italic>, pre-immune serum. Actin was used as the loading control. <bold>(D)</bold> Immunofluorescence of the EhVps35 protein using the &#x3b1;-EhVps35 antibodies and FITC-labeled &#x3b1;-mouse secondary antibodies in permeabilized and non-permeabilized trophozoites. DAPI (<italic>blue</italic>): nuclei. Controls: FITC secondary antibody and PS. <italic>Scale bar</italic>, 10 &#x3bc;m. <bold>(E&#x2013;F)</bold> TEM localization of the EhVps35 protein in trophozoites. (<italic>e1</italic>) Magnification of the <italic>discontinuous black square</italic> in <bold>(E)</bold>, marked with <italic>1</italic>. <bold>(F)</bold> EhVps35 in vesicle membranes. (<italic>f1</italic>) Magnification of the <italic>discontinuous black square</italic> in <bold>(F)</bold> marked with <italic>1</italic>. <bold>(G)</bold> Scheme of the tubular structure formation that putatively will constitute the retromer. <bold>(H)</bold> Control trophozoites using only secondary antibodies. <italic>es</italic>, extracellular space; <italic>pm</italic>, plasma membrane; <italic>v</italic>, vesicles. <italic>Arrowheads</italic> denote EhVps35.</p>
</caption>
<graphic mimetype="image" mime-subtype="tiff" xlink:href="fpara-03-1356601-g002.tif"/>
</fig>
<p>With a confocal microscope, in permeabilized trophozoites, the antibodies were shown to detect the EhVps35 protein in clusters, some of them located in vesicles scattered in the cytoplasm and near the plasma membrane (<xref ref-type="fig" rid="f2">
<bold>Figure&#xa0;2D</bold>
</xref>). Intriguingly, in non-permeabilized trophozoites, the EhVps35 protein appeared in the plasma membrane (<xref ref-type="fig" rid="f2">
<bold>Figure&#xa0;2D</bold>
</xref>), and TEM assays confirmed that it was located on the outer face of the plasma membrane and in vesicle membranes (<xref ref-type="fig" rid="f2">
<bold>Figure&#xa0;2E</bold>
</xref>, e1). Interestingly, EhVps35 was observed in elongated structures, suggesting that membrane remodeling possibly occurred at these points, an event necessary for protein recycling (<xref ref-type="fig" rid="f2">
<bold>Figure&#xa0;2F</bold>
</xref>, f1). The scheme in <xref ref-type="fig" rid="f2">
<bold>Figure&#xa0;2G</bold>
</xref> shows a diagram of the vesicle projections that could be forming the tubular retromer structures described in other systems (<xref ref-type="bibr" rid="B5">Bonifacino and Hurley, 2008</xref>; <xref ref-type="bibr" rid="B68">van Weering et&#xa0;al., 2010</xref>), and <xref ref-type="fig" rid="f2">
<bold>Figure&#xa0;2H</bold>
</xref> corresponds to the control treated with secondary antibody.</p>
</sec>
<sec id="s3_3">
<label>3.3</label>
<title>EhVps35 is involved in phagocytosis</title>
<p>Phagocytosis is one of the landmarks of trophozoite virulence. This function requires high activity in membrane remodeling to form the phagocytic cups and channels, the endosomes, the multivesicular bodies (MVBs), and other vesicles. At the same time, protein recycling is needed in the cell to reuse certain molecules and save energy. Thus, being a complex involved in the selection and recycling of proteins, the retromer may also be involved in phagocytosis.</p>
<p>We explored the fate of the EhVps35 protein under the RBC stimulus, tracking the protein with the &#x3b1;-EhVps35 antibodies and the FITC-labeled &#x3b1;-mouse secondary antibodies. Confocal images revealed that after 2&#xa0;min contact of the trophozoites with RBCs, the EhVps35 protein was translocated at the contact site of both cells and was visualized decorating the adhered RBCs, as has been previously reported for the EhSNX1 and EhVps26 retromeric proteins (<xref ref-type="bibr" rid="B51">Nakada-Tsukui et&#xa0;al., 2005</xref>; <xref ref-type="bibr" rid="B64">Srivastava et&#xa0;al., 2017</xref>; <xref ref-type="bibr" rid="B70">Watanabe et&#xa0;al., 2020</xref>). EhVps35 was also found in the ingested RBCs, which confirms the high mobility of this protein from the vesicle membranes to the plasma membrane and <italic>vice versa</italic>, suggesting that the retromer acts in concert with other molecules during phagocytosis.</p>
<p>In some experiments, after 2&#xa0;min of phagocytosis, the adhered and non-ingested RBCs were removed by mild osmotic shock and then incubated again in TYI medium. These pulse-chase experiments were carried out to follow the fate of the already ingested cells, without the noise of other RBCs recently adhered and ingested. In these experiments, at 5 (2&#xa0;+&#xa0;3) and 15 (2&#xa0;+&#xa0;13) min, the antibodies again detected the EhVps35 protein in cytoplasmic vesicles, as well as on and in ingested erythrocytes. At 30 (2&#xa0;+&#xa0;28) min, the protein was located on and around the ingested erythrocytes and in phagosomes (<xref ref-type="fig" rid="f3">
<bold>Figure&#xa0;3A</bold>
</xref>). Our experiments showed that EhVps35, as are other retromeric proteins (<xref ref-type="fig" rid="f3">
<bold>Figure&#xa0;3B</bold>
</xref>) (<xref ref-type="bibr" rid="B51">Nakada-Tsukui et&#xa0;al., 2005</xref>, <xref ref-type="bibr" rid="B50">2009</xref>; <xref ref-type="bibr" rid="B70">Watanabe et&#xa0;al., 2020</xref>), is located in the vesicle membranes that surround the ingested erythrocytes. Our results also evidenced that EhVps35, as are other proteins involved in phagocytosis (<xref ref-type="bibr" rid="B2">Avalos-Padilla et&#xa0;al., 2015</xref>; <xref ref-type="bibr" rid="B18">Galindo et&#xa0;al., 2021</xref>), follows the path of the ingested target cell.</p>
<fig id="f3" position="float">
<label>Figure&#xa0;3</label>
<caption>
<p>Fate of EhVps35 during phagocytosis. Trophozoites were incubated at 37&#xb0;C with red blood cells (RBCs) (1:25) for 2&#xa0;min, then non-ingested RBCs were removed by mild osmotic shock and incubated again in TYI medium as described in <italic>Materials and methods</italic>. <bold>(A)</bold> Immunofluorescent confocal images of the trophozoites at different times of phagocytosis using &#x3b1;-EhVps35 and the FITC-labeled secondary antibody. DAPI (<italic>blue</italic>): nuclei. <italic>Left</italic>: Incubation time in minutes. <italic>Zoomed-in images</italic> correspond to the regions marked with <italic>white squares</italic> in each row. <italic>e</italic>, erythrocytes. <italic>Scale bar</italic>, 10 &#x3bc;m. <bold>(B)</bold> Fluorescence intensity of the trophozoites in the plasma membrane at 0 and 2&#xa0;min of phagocytosis. ***<italic>p</italic> &lt; 0.001. <bold>(C)</bold> Western blot corresponding to the lysates of trophozoites at different times of phagocytosis. Actin was used as the loading control. <bold>(D)</bold> Densitometry analyses of the EhVps35 protein in Western blot assays at different times of phagocytosis. *<italic>p</italic> &lt; 0.05; **<italic>p</italic> &lt; 0.01.</p>
</caption>
<graphic mimetype="image" mime-subtype="tiff" xlink:href="fpara-03-1356601-g003.tif"/>
</fig>
<p>Intriguingly, the Western blot assays of the lysates obtained from the trophozoite&#x2013;RBC mixture revealed that the amount of EhVps35 protein apparently decreased during phagocytosis (<xref ref-type="fig" rid="f3">
<bold>Figure&#xa0;3C</bold>
</xref>). Densitometry analysis confirmed that, after 10&#xa0;min of phagocytosis, the EhVps35 protein significantly decreased between 20% and 40% with respect to the 0 time (<xref ref-type="fig" rid="f3">
<bold>Figure&#xa0;3D</bold>
</xref>). This condition could be due to the partial degradation of the cellular amount of this protein during phagocytosis. Actin was used as a control to normalize the data for quantification (<xref ref-type="fig" rid="f3">
<bold>Figures&#xa0;3C, D</bold>
</xref>).</p>
<p>The TEM images, using gold-labeled secondary antibodies, confirmed that, after 5&#xa0;min of phagocytosis, the EhVps35 protein was located at the contact sites of the trophozoites with RBCs, as observed in confocal images (<xref ref-type="fig" rid="f4">
<bold>Figure&#xa0;4A</bold>
</xref>, a1). Subsequently, EhVps35 was observed in the RBC-containing phagosomes. The gold label appeared mainly in the endosome and phagosome membranes, where it could have undergone an eventual membrane remodeling, which is necessary for protein recycling (<xref ref-type="fig" rid="f4">
<bold>Figures&#xa0;4B&#x2013;D</bold>
</xref>, b1 - d1, respectively). In TEM assays, the RBC-containing phagosomes presented white intricate arrangements (WIAs) that have been reported in other studies on proteins involved in phagocytosis (<xref ref-type="bibr" rid="B2">Avalos-Padilla et&#xa0;al., 2015</xref>; <xref ref-type="bibr" rid="B18">Galindo et&#xa0;al., 2021</xref>). These WIAs could partially correspond to the digested hemoglobin that is inside these vesicular structures, which have not been thoroughly described. However, the location of the EhVps35 protein in the WIAs could also suggest that the retromer carried out its function of selecting proteins to recycle them to different cellular compartments (<xref ref-type="fig" rid="f4">
<bold>Figure&#xa0;4E</bold>
</xref>, e1). More experimental evidence is necessary to confirm this hypothesis.</p>
<fig id="f4" position="float">
<label>Figure&#xa0;4</label>
<caption>
<p>TEM localization of EhVps35 in trophozoites during erythrophagocytosis. <bold>(A)</bold> EhVps35 (<italic>arrowheads</italic>) in the plasma membrane and at the sites of contact of the trophozoites with RBCs. (<italic>a1</italic>) Magnification of the region marked with a <italic>discontinuous white square</italic> in <bold>(A)</bold>, marked with <italic>1</italic>. <bold>(B)</bold> Red blood cell (RBC)-containing phagosomes where the EhVps35 protein (<italic>arrowheads</italic>) was observed in the membrane. (<italic>b1</italic>) Magnification of the region marked with a <italic>discontinuous white square</italic> in <bold>(B)</bold>, marked with <italic>1</italic>. <bold>(C, D)</bold> EhVps35 protein (<italic>arrowheads</italic>) in white double-membrane structures inside phagosomes. (<italic>c1</italic>, <italic>d1</italic>) Magnification of the region marked with a <italic>discontinuous white square</italic> in <bold>(C, D)</bold>, marked with <italic>1</italic>. <bold>(E)</bold> Location of the EhVps35 protein (<italic>arrowhead</italic>) in white intricate structures (WIAs). (<italic>e1</italic>) Magnification of the region marked with a <italic>discontinuous white square</italic> in <bold>(E)</bold>, marked with <italic>1</italic>. <italic>es</italic>, extracellular space; <italic>pm</italic>, plasma membrane; <italic>v</italic>, vesicles; <italic>e</italic>, erythrocytes.</p>
</caption>
<graphic mimetype="image" mime-subtype="tiff" xlink:href="fpara-03-1356601-g004.tif"/>
</fig>
</sec>
<sec id="s3_4">
<label>3.4</label>
<title>EhVps35 participates in plasma membrane protein recycling</title>
<p>To experimentally demonstrate that recycling occurred in the trophozoites in this study and that the EhVps35 protein is involved in this function, we knocked down the <italic>Ehvps35</italic> gene using dsRNA (<xref ref-type="bibr" rid="B63">Solis et&#xa0;al., 2009</xref>). Western blot assays using silenced trophozoites (<italic>Ehvps35</italic>-KD) evidenced that they expressed approximately 60% less EhVps35 than the control (<xref ref-type="fig" rid="f5">
<bold>Figures&#xa0;5A, B</bold>
</xref>). The results of the immunofluorescence assays corroborated these findings (<xref ref-type="fig" rid="f5">
<bold>Figures&#xa0;5C, D</bold>
</xref>). Subsequently, we used biotin (S-NHS-SS-Biotin) to label the plasma membrane proteins (<xref ref-type="bibr" rid="B4">Biller et&#xa0;al., 2014</xref>). Under a confocal microscope, the biotinylated trophozoites, maintained at 4&#xb0;C, displayed the plasma membrane proteins uniformly labeled in both the control and <italic>Ehvps35</italic>-KD trophozoites (<xref ref-type="fig" rid="f5">
<bold>Figure&#xa0;5E</bold>
</xref>, 1). Thereafter, the trophozoites were incubated for 15&#xa0;min at 37&#xb0;C and the label internalized in both cell types (<xref ref-type="fig" rid="f5">
<bold>Figure&#xa0;5E</bold>
</xref>, 2). Interestingly, after 20&#xa0;min incubation at 37&#xb0;C, the labeled proteins returned to the plasma membrane in the control trophozoites, but not in the <italic>Ehvps35</italic>-KD trophozoites (<xref ref-type="fig" rid="f5">
<bold>Figure&#xa0;5E</bold>
</xref>, 4). The incubation time at 37&#xb0;C was augmented to 40&#xa0;min; however, recycling in the <italic>Ehvps35</italic>-KD trophozoites remained poor (<xref ref-type="fig" rid="f5">
<bold>Figure&#xa0;5E</bold>
</xref>, 4). After quantification of the fluorescence intensity in the plasma membrane, these assays confirmed that significant recycling reductions of 50% and 60% occurred in the <italic>Ehvps35</italic>-KD trophozoites compared to the control (<xref ref-type="fig" rid="f5">
<bold>Figure&#xa0;5F</bold>
</xref>). These results strongly suggest that the EhVps35 protein, even when located in the plasma membrane, does not participate in the introduction of the target cell, but has a vital role in protein recycling.</p>
<fig id="f5" position="float">
<label>Figure&#xa0;5</label>
<caption>
<p>Recycling of the biotinylated proteins by EhVps35. <bold>(A)</bold> Western blot assays using non-silenced (control) and silenced (knocked down <italic>Ehvps35</italic>, <italic>Ehvps35-KD</italic>) trophozoites. <bold>(B)</bold> Densitometric analysis of the bands shown in <bold>(A)</bold> normalized against the actin protein bands. <bold>(C)</bold> Representative images of the confocal microscopy of the control and <italic>Ehvps35</italic>-KD trophozoites under basal condition using the &#x3b1;-EhVps35 and FITC-labeled antibodies (<italic>green</italic>). <italic>Scale bar</italic>, 10 &#x3bc;m. <bold>(D)</bold> Fluorescence intensity of the images in <bold>(C)</bold> measured in pixels. <bold>(E)</bold> The trophozoites were processed to follow the recycling process as described in <italic>Materials and methods</italic>. The <italic>upper section</italic> shows the scheme of the recycling process. <italic>0</italic>, Untreated cells. <italic>1</italic>, Biotin-labeled plasma membrane proteins (<italic>red</italic>) in the trophozoites at 4&#xb0;C. <italic>2</italic>, Internalization of the labeled proteins at 37&#xb0;C. <italic>3</italic>, Removal of the biotinylated proteins in the plasma membrane using DTT. <italic>4</italic>, Recycling to the plasma membrane of the stained proteins at 37&#xb0;C. <italic>Lower panel</italic> shows confocal images of the control and <italic>Ehvps35</italic>-KD trophozoites following the steps in the upper scheme. <italic>Scale bar</italic>, 10 &#x3bc;m. <bold>(F)</bold> Fluorescence intensity measured in the plasma membrane of trophozoites at 20 and 40 min. ***<italic>p</italic> &lt; 0.001.</p>
</caption>
<graphic mimetype="image" mime-subtype="tiff" xlink:href="fpara-03-1356601-g005.tif"/>
</fig>
</sec>
<sec id="s3_5">
<label>3.5</label>
<title>Three-dimensional model of EhVps35</title>
<p>To analyze the interaction of EhVps35 with the other membrane proteins involved in phagocytosis, the complete EhVps35 3D model was used. A previous report showed the 3D design of the EhVps35 carboxy terminus (<xref ref-type="bibr" rid="B64">Srivastava et&#xa0;al., 2017</xref>), but not the complete protein. Here, we obtained the full 3D protein structure from the I-TASSER server (<xref ref-type="fig" rid="f6">
<bold>Figure&#xa0;6D</bold>
</xref>). The structural alignment of this model exhibited a root mean square deviation (RMSD) of 1.07 &#xc5; with the HsVps35 (PDB:7BLN:C) crystal ortholog (<xref ref-type="fig" rid="f6">
<bold>Figure&#xa0;6F</bold>
</xref>). Analysis of the MDS trajectory measured using RMSD indicated that EhVps35 has an unstable trajectory oscillating &#xb1;3 &#xc5;, and it is independent of the simulation time (<xref ref-type="fig" rid="f6">
<bold>Figure&#xa0;6A</bold>
</xref>). The radius of gyration (<italic>R</italic>
<sub>g</sub>) data confirmed that EhVps35 is an extended protein that is compacted during the MDS in the first 25 ns, after which is compacted again at 100 ns and expanded after 100&#x2013;150 ns, remaining unchanged until the end of the simulation (<xref ref-type="fig" rid="f6">
<bold>Figure&#xa0;6B</bold>
</xref>). However, the root mean square fluctuation (RMSF) values showed a high movement of the protein in the N-terminus region from 1 to 199 amino acids and at the C-terminus from 501 to 757 amino acids (<xref ref-type="fig" rid="f6">
<bold>Figure&#xa0;6C</bold>
</xref>). This analysis showed that EhVps35 has the 3D model described for its orthologs as an &#x3b1;-solenoid protein (<xref ref-type="fig" rid="f6">
<bold>Figure&#xa0;6E</bold>
</xref>) (<xref ref-type="bibr" rid="B27">Hierro et&#xa0;al., 2007</xref>; <xref ref-type="bibr" rid="B40">Lucas et&#xa0;al., 2016</xref>) containing 33 &#x3b1;-helices (<xref ref-type="fig" rid="f6">
<bold>Figure&#xa0;6D</bold>
</xref>), confirming that EhVps35 is indeed an ortholog of the HsVps35 protein in humans.</p>
<fig id="f6" position="float">
<label>Figure&#xa0;6</label>
<caption>
<p>EhVps35 molecular dynamics stimulation (MDS) and the predicted 3D model. <bold>(A)</bold> Root mean square deviation (RMSD). <bold>(B)</bold> Radius of gyration (<italic>R</italic>
<sub>g</sub>). <bold>(C)</bold> Root mean square fluctuation (RMSF). <italic>Brackets</italic> in RMSF indicate the most flexible regions. <bold>(D)</bold> Three-dimensional EhVps35 model. <bold>(E)</bold> Three-dimensional HsVps35 model. <bold>(F)</bold> Overlapping of EhVps35 and HsVps35.</p>
</caption>
<graphic mimetype="image" mime-subtype="tiff" xlink:href="fpara-03-1356601-g006.tif"/>
</fig>
</sec>
<sec id="s3_6">
<label>3.6</label>
<title>
<italic>In silico</italic> EhVps35 binding to EhADH</title>
<p>Once the EhVps35 model was obtained, docking analysis was carried out between EhVps35 and EhADH using the 3D EhADH model already reported (<xref ref-type="bibr" rid="B49">Monta&#xf1;o et&#xa0;al., 2017</xref>). The docking results predicted that EhVps35 interacts with EhADH with a global free energy of &#x394;<italic>G</italic> = &#x2212;920.6, given by two salt bridges and 19 hydrogen bonds (<xref ref-type="fig" rid="f7">
<bold>Figure&#xa0;7A</bold>
</xref>). The EhVps35 residues that interacted with EhADH were H271, E312, L315, D316, Q320, R321, N323, S329, and Y233. On the other hand, in EhADH, these were K98, K100, Y445, Y457, R663, Q673, Q674, P675, Y676, G679, T680, and N681. The binding of EhADH to EhVps35 did not interfere with the Bro1 or adhesion domains in the EhADH protein as, except for the K98, K100, and Y457 amino acids that appeared located in these domains, most of the EhADH residues appeared situated at the C-terminus after the adhesion domain.</p>
<fig id="f7" position="float">
<label>Figure&#xa0;7</label>
<caption>
<p>Molecular docking of EhVps35 and EhADH and immunoprecipitation assays. <bold>(A)</bold> Three dimensions of the conformational model of the binding of EhVps35 (<italic>red</italic>) and EhADH (<italic>green</italic>). <italic>Lower panels</italic>: Schematic representation of the amino acid residues that participate in the interaction between these molecules. <bold>(B)</bold> Immunoprecipitation of EhADH, Gal/GalNac, and actin using &#x3b1;-EhVps35. HM1 trophozoites in basal conditions were lysed and immunoprecipitated using the &#x3b1;-EhVps35 antibody or pre-immune serum (PS). Immunoprecipitated proteins were analyzed by Western blot using the &#x3b1;-EhVps35, &#x3b1;-EhADH, &#x3b1;-Hgl Gal/GalNac, and &#x3b1;-actin antibodies.</p>
</caption>
<graphic mimetype="image" mime-subtype="tiff" xlink:href="fpara-03-1356601-g007.tif"/>
</fig>
</sec>
<sec id="s3_7">
<label>3.7</label>
<title>Experimental binding of EhVps35 to EhADH, Gal/GalNac lectin, and actin</title>
<p>Subsequently, we experimentally examined the EhVps35&#x2013;EhADH binding with immunoprecipitation assays using the &#x3b1;-EhVps35 antibodies for precipitation and the total trophozoite extracts. The Western blot assays revealed that the &#x3b1;-EhADH antibodies recognized a 75-kDa protein in the immunoprecipitates, corresponding to the EhADH protein migration (<xref ref-type="fig" rid="f7">
<bold>Figure&#xa0;7B</bold>
</xref>). These results strongly suggest the association of EhVps35 with EhADH, a molecule that is actively mobilized during phagocytosis (<xref ref-type="bibr" rid="B1">Arroyo and Orozco, 1987</xref>; <xref ref-type="bibr" rid="B19">Garc&#xed;a-Rivera et&#xa0;al., 1999</xref>). Considering the docking analysis, the binding of EhVps35 and EhADH could occur by direct interaction; however, we cannot rule out that an indirect link can also happen.</p>
<p>In these experiments, we searched for the Gal/GalNac lectin, another membrane protein mobilized during virulence events (<xref ref-type="bibr" rid="B55">Petri et&#xa0;al., 2002</xref>; <xref ref-type="bibr" rid="B16">Frederick and Petri, 2005</xref>), and for actin as, during the retromer function, it binds to EhSNX-1 and EhSNX-1 interacts with the EhVps35 protein (<xref ref-type="bibr" rid="B70">Watanabe et&#xa0;al., 2020</xref>). In addition, Gal/GalNac lectin binds to actin and to other cytoskeletal proteins (<xref ref-type="bibr" rid="B45">McCoy and Mann, 2005</xref>). The EhVps35, EhADH, Gal/GalNac, and actin proteins appeared in the immunoprecipitates obtained with the &#x3b1;-EhVps35 antibody, strongly suggesting that they bind to each other. The pre-immune serum did not recognize any band (<xref ref-type="fig" rid="f7">
<bold>Figure&#xa0;7B</bold>
</xref>).</p>
</sec>
<sec id="s3_8">
<label>3.8</label>
<title>EhVps35 participates in the recycling of the EhADH and Gal/GalNac proteins</title>
<p>Once the association of EhVps35 with EhADH and Gal/GalNac was confirmed, we proceeded to investigate whether the retromer recycles these proteins using the <italic>Ehvps35</italic>-KD trophozoites and the respective antibodies against the two proteins. Firstly, under a confocal microscope, the &#x3b1;-EhVps35, &#x3b1;-EhADH, and &#x3b1;-Hgl Gal/GalNac antibodies in the control trophozoites were detected to co-localize in the plasma membrane and in some cytoplasmic regions (<xref ref-type="fig" rid="f8">
<bold>Figure&#xa0;8A</bold>
</xref>), suggesting the formation of EhADH and Gal/GalNac protein complexes associated with EhVps35. In contrast, in the <italic>Ehvps35</italic>-KD trophozoites, the fluorescent signals of the three antibodies were poor (<xref ref-type="fig" rid="f8">
<bold>Figure&#xa0;8A</bold>
</xref>). Weak labeling was also observed in dots scattered in the cytoplasm, without visible labels in the plasma membrane. The three antibodies also exhibited very poor co-localization in <italic>Ehvps35</italic>-KD trophozoites (<xref ref-type="fig" rid="f8">
<bold>Figure&#xa0;8</bold>
</xref>). These experiments demonstrated that, when the EhVps35 protein is poorly expressed, the recycling of EhADH and Gal/GalNac lectin is affected, strongly supporting the participation of EhVps35 in this event.</p>
<fig id="f8" position="float">
<label>Figure&#xa0;8</label>
<caption>
<p>Recycling of Gal/GalNac and EhADH by EhVps35. <bold>(A, B)</bold> Confocal images of EhVps35 (<italic>green</italic>), EhADH (<italic>red</italic>), and Gal/GalNac (<italic>blue</italic>) during recycling as described in the <italic>Material and methods</italic>. Cycloheximide-treated (<italic>+CHX</italic>) and untreated (<italic>&#x2212;CHX</italic>) trophozoites of the non-silenced (control) and silenced (knocked down <italic>Ehvps35</italic>, <italic>Ehvps35-KD</italic>) trophozoites. <italic>Arrows</italic> denote proteins that co-localized in the plasma membrane. <italic>Arrowheads</italic> indicate proteins that co-localized in the cytoplasm. <italic>Asterisk</italic> represents the co-localization of EhVps35 and EhADH in the cytoplasm of <italic>Ehvps35</italic>-KD trophozoites. <italic>Scale bar</italic>, 10 &#x3bc;m. <bold>(C)</bold> Western blot assays of the control and <italic>Ehvps35</italic>-KD trophozoites. <italic>Right</italic>: Name of the antibodies. <italic>Left</italic>: Molecular weights of the revealed protein. <bold>(D&#x2013;G)</bold> Densitometric analysis of the bands shown in <bold>(C)</bold> normalized against the EhVps23 protein. *<italic>p</italic> &lt; 0.05; **<italic>p</italic> &lt; 0.01.</p>
</caption>
<graphic mimetype="image" mime-subtype="tiff" xlink:href="fpara-03-1356601-g008.tif"/>
</fig>
<p>Subsequently, to avoid interference of the proteins that were <italic>de novo</italic> synthesized and then transported to the plasma membrane, we used CHX to stop the protein synthesis and followed only those proteins present in the cell at the beginning of the recycling experiments. In the confocal images of control cells, the &#x3b1;-EhVps35, &#x3b1;-Hgl Gal/GalNac, and &#x3b1;-EhADH antibodies were again detected in the plasma membrane (<xref ref-type="fig" rid="f8">
<bold>Figure&#xa0;8B</bold>
</xref>, arrow) and in some dots in the cytoplasm (<xref ref-type="fig" rid="f8">
<bold>Figure&#xa0;8B</bold>
</xref>, arrowhead). The three proteins appeared to mainly co-localize in clusters in the plasma membrane, suggesting that CHX did not affect their interaction, nor the morphology of the trophozoites, as can be observed in the phase-contrast images (<xref ref-type="fig" rid="f8">
<bold>Figures&#xa0;8A, B</bold>
</xref>). Cell viability was neither affected, which was measured using trypan blue exclusion. In contrast, the <italic>Ehvps35</italic>-KD cells showed poor fluorescence labels, and their cellular location was also disturbed due to the proteins remaining scattered in the cytoplasm, but not in the plasma membrane (<xref ref-type="fig" rid="f8">
<bold>Figure&#xa0;8B</bold>
</xref>). Several <italic>Ehvps35</italic>-KD trophozoites presented a large cytoplasmic vesicle labeled by antibodies against the remnant EhVps35 and EhADH, and protein co-localization appeared poor and in small cytoplasmic vesicles (<xref ref-type="fig" rid="f8">
<bold>Figure&#xa0;8B</bold>
</xref>). These results confirmed that the recycling of EhADH and Gal/GalNac proteins was affected by the knockdown of the <italic>Ehvps35</italic> gene.</p>
<p>To further explore the decrease of the EhADH and Gal/GalNac proteins observed in <italic>Ehvps35</italic> knockdown, Western blot assays were performed using the lysates from untreated and CHX-treated trophozoites. In untreated <italic>Ehvps35</italic>-KD trophozoites, the Gal/GalNac protein significantly decreased (<xref ref-type="fig" rid="f8">
<bold>Figures&#xa0;8C, D, F</bold>
</xref>), but the EhADH and actin proteins did not show apparent changes (<xref ref-type="fig" rid="f8">
<bold>Figures&#xa0;8C, E, G</bold>
</xref>). In contrast, in CHX-treated <italic>Ehvps35</italic>-KD trophozoites, the EhADH, Gal/GalNac, and actin proteins significantly decreased between 20% and 60% with respect to the control trophozoites (<xref ref-type="fig" rid="f8">
<bold>Figures&#xa0;8C&#x2013;G</bold>
</xref>). The &#x3b1;-EhVps23 antibody was used to normalize the data. These results suggest a possible degradation of EhADH, Gal/GalNac, and actin in the absence of the EhVps35 protein and the treatment with CHX.</p>
</sec>
<sec id="s3_9">
<label>3.9</label>
<title>In <italic>Ehvps35-KD</italic> trophozoites, the EhADH protein is localized mainly in acidic vesicles</title>
<p>Previous studies have shown that EhADH can be located in acidic vesicles during phagocytosis (<xref ref-type="bibr" rid="B7">Castellanos-Castro et&#xa0;al., 2016</xref>), suggesting that a portion of this protein is conducted to degradation and another portion is recycled, as shown here (<xref ref-type="fig" rid="f8">
<bold>Figures&#xa0;8A, B</bold>
</xref>). Thus, LysoTracker was used to investigate whether EhADH appeared in acidic vesicles in the control and the CHX-treated <italic>Ehvps35</italic>-KD trophozoites. In basal conditions, the control trophozoites showed that the EhVps35 and EhADH proteins co-localized, but their co-localization with LysoTracker was low. Interestingly, the CHX-treated <italic>Ehvps35</italic>-KD trophozoites showed higher co-localization of both proteins with LysoTracker (<xref ref-type="fig" rid="f9">
<bold>Figures&#xa0;9A&#x2013;F</bold>
</xref>). These results suggest that a greater degradation of both proteins could have occurred in <italic>Ehvps35</italic>-KD trophozoites compared to the control. After phagocytosis (2&#xa0;min), in the control trophozoites, the EhVps35 and EhADH proteins moved to the contact site with RBCs. In contrast, the <italic>Ehvps35</italic>-KD trophozoites appeared poorly labeled and the protein co-localization with LysoTracker was also poor (<xref ref-type="fig" rid="f9">
<bold>Figures&#xa0;9A&#x2013;F</bold>
</xref>). In the control cells, after 30&#xa0;min of phagocytosis, the EhVps35 and EhADH proteins re-localized to the plasma membrane and co-localized with LysoTracker in some RBC-containing phagosomes, suggesting that, during phagocytosis, a portion of them were conducted to degradation. In contrast, the CHX-treated <italic>Ehvps35</italic>-KD trophozoites presented fewer acidic vesicles, the EhADH protein did not return to the plasma membrane, and EhVps35 and EhADH remained in small points in the cytoplasm, with some of them co-localizing with LysoTracker (<xref ref-type="fig" rid="f9">
<bold>Figures&#xa0;9A, F</bold>
</xref>). Quantitative data of the fluorescence intensity of the EhVps35 and EhADH proteins and the acidic vesicle marker showed a significant reduction (60%&#x2013;80%) in <italic>Ehvps35</italic>-KD trophozoites compared to the control cells (<xref ref-type="fig" rid="f9">
<bold>Figures&#xa0;9B&#x2013;D</bold>
</xref>). These results strengthened the assumption that EhADH is degraded in the absence of the EhVps35 protein, and these remark the importance of the retromer in phagocytosis, recycling and preserving the proteins participating in these events.</p>
<fig id="f9" position="float">
<label>Figure&#xa0;9</label>
<caption>
<p>Recycling and co-localization of EhADH in acidic structures. <bold>(A)</bold> Localization of the EhVps35 protein (<italic>green</italic>), EhADH protein (<italic>red</italic>), and the acidic structures (<italic>blue</italic>) in cycloheximide-treated (<italic>+CHX</italic>) non-silenced (control) and <italic>Ehvps35</italic>-KD trophozoites. <italic>Arrows</italic> indicate the co-localization sites of the EhVps35 and EhADH proteins in the plasma membrane. <italic>Arrowheads</italic> denote the co-localization sites of the EhVps35 and EhADH proteins with acidic structures in the cytoplasm. <italic>Scale bar</italic>, 10 &#x3bc;m. <bold>(B)</bold> Magnification of the regions marked with a <italic>discontinuous white square</italic> in <bold>(A)</bold> at 30&#xa0;min. <bold>(C&#x2013;E)</bold> Fluorescence intensity of EhVps35, EhADH, and LysoTracker measured in pixels. <bold>(F)</bold> Pearson&#x2019;s coefficient for EhADH and LysoTracker co-localization. **<italic>p</italic> &lt; 0.01; ***<italic>p</italic> &lt; 0.001.</p>
</caption>
<graphic mimetype="image" mime-subtype="tiff" xlink:href="fpara-03-1356601-g009.tif"/>
</fig>
</sec>
<sec id="s3_10">
<label>3.10</label>
<title>Actin disruption in <italic>Ehvps35</italic>-KD trophozoites</title>
<p>The Western blot assays revealed a decrease of actin in <italic>Ehvps35</italic>-KD trophozoites (<xref ref-type="fig" rid="f8">
<bold>Figures&#xa0;8C, D</bold>
</xref>). To explore whether the actin cytoskeleton was affected by the <italic>Ehvps35</italic> gene silencing, confocal microscopy assays were performed using CHX-treated trophozoites. In basal conditions, in the control trophozoites, EhVps35 and F-actin again co-localized mainly near the plasma membrane and in cytoplasmic structures, as described (<xref ref-type="bibr" rid="B41">Manich et&#xa0;al., 2018</xref>a). In contrast, <italic>Ehvps35</italic>-KD trophozoites presented the diminished fluorescence intensity of F-actin and disorganization of the actin cytoskeleton (<xref ref-type="fig" rid="f10">
<bold>Figures&#xa0;10A&#x2013;C</bold>
</xref>). After 2&#xa0;min of phagocytosis, the control trophozoites displayed the EhVps35 and F-actin proteins relocated to the contact site with the RBCs, decorating the phagocytic cups and channels (<xref ref-type="fig" rid="f10">
<bold>Figure&#xa0;10A</bold>
</xref>). However, these structures were not observed in the <italic>Ehvps35</italic>-KD trophozoites, suggesting that the silencing of the <italic>Ehvps35</italic> gene affected the structuring of the actin cytoskeleton, which is necessary in the formation of phagocytic cups and channels (<xref ref-type="fig" rid="f10">
<bold>Figures&#xa0;10A, B</bold>
</xref>). Quantitative data of the fluorescence intensity of the EhVps35 and F-actin proteins showed a reduction of 40%&#x2013;70% in <italic>Ehvps35</italic>-KD trophozoites compared to the control cells (<xref ref-type="fig" rid="f10">
<bold>Figures&#xa0;10B, C</bold>
</xref>). Co-localization analysis between EhVps35 and F-actin showed an increase in the control trophozoites after 2&#xa0;min of phagocytosis, while the <italic>Ehvps35</italic>-KD trophozoites remained constant. Furthermore, in <italic>EhVps35</italic>-KD trophozoites, the co-localization between EhVps35 and F-actin was significantly lower compared to that in the control trophozoites (<xref ref-type="fig" rid="f10">
<bold>Figure&#xa0;10D</bold>
</xref>). These results suggest that CHX treatment did not affect the structure of the actin cytoskeleton. To obtain more insights on the relationship between the EhVps35 protein and actin cytoskeleton structuring, the immunoprecipitates with &#x3b1;-EhVps35 antibodies were analyzed using mass spectrometry. EhVps35-bound proteins were selected after comparison to previous proteomic analyses of the actin cytoskeleton in <italic>E. histolytica</italic> (<xref ref-type="bibr" rid="B41">Manich et&#xa0;al., 2018</xref>; <xref ref-type="bibr" rid="B59">Rath and Gourinath, 2020</xref>). The results revealed 33 cytoskeleton-associated proteins, including actin and cytoskeleton modulator proteins (<xref ref-type="table" rid="T1">
<bold>Table&#xa0;1</bold>
</xref>).</p>
<fig id="f10" position="float">
<label>Figure&#xa0;10</label>
<caption>
<p>Actin cytoskeleton disruption during the phagocytosis in <italic>Ehvps35</italic> knockdown (<italic>Ehvps35</italic>-KD) trophozoites. <bold>(A)</bold> Localization of EhVps35 (<italic>green</italic>) and actin (<italic>red</italic>) in the non-silenced (control) and silenced (<italic>Ehvps35</italic>-KD) trophozoites after 0 and 2&#xa0;min of phagocytosis. <italic>Arrows</italic> denote the co-localization of the EhVps35 and actin proteins near the plasma membrane. <italic>Arrowheads</italic> indicate the co-localization of EhVps35 and actin in phagocytic cups and the channels. <italic>Scale bar</italic>, 10 &#x3bc;m. <bold>(B, C)</bold> Fluorescence intensity of EhVps35 and actin measured in pixels. <bold>(D)</bold> Pearson&#x2019;s coefficient for EhVps35 and actin co-localization. **<italic>p</italic> &lt; 0.01; ***<italic>p</italic> &lt; 0.001.</p>
</caption>
<graphic mimetype="image" mime-subtype="tiff" xlink:href="fpara-03-1356601-g010.tif"/>
</fig>
<table-wrap id="T1" position="float">
<label>Table&#xa0;1</label>
<caption>
<p>Proteins associated with EhVps35 and related to the actin cytoskeleton.</p>
</caption>
<table frame="hsides">
<thead>
<tr>
<th valign="middle" align="center">Protein</th>
<th valign="middle" align="center">Accession number</th>
</tr>
</thead>
<tbody>
<tr>
<td valign="top" align="center">Actin</td>
<td valign="middle" align="center">EHI_140120/EHI_126190/EHI_161200/EHI_182900</td>
</tr>
<tr>
<td valign="top" align="center">Profilin 1</td>
<td valign="middle" align="center">EHI_176140</td>
</tr>
<tr>
<td valign="top" align="center">CAP</td>
<td valign="middle" align="center">EHI_136150/EHI_081430</td>
</tr>
<tr>
<td valign="top" align="center">ARPC2</td>
<td valign="middle" align="center">EHI_199690</td>
</tr>
<tr>
<td valign="top" align="center">ARP2</td>
<td valign="middle" align="center">EHI_111050</td>
</tr>
<tr>
<td valign="top" align="center">ARPC1</td>
<td valign="middle" align="center">EHI_045000</td>
</tr>
<tr>
<td valign="top" align="center">ARP3</td>
<td valign="middle" align="center">EHI_198930</td>
</tr>
<tr>
<td valign="top" align="center">Myosin-II</td>
<td valign="middle" align="center">EHI_110180</td>
</tr>
<tr>
<td valign="top" align="center">Bin1/Endophilin</td>
<td valign="middle" align="center">EHI_187770</td>
</tr>
<tr>
<td valign="top" align="center">Cortexillin</td>
<td valign="middle" align="center">EHI_083140</td>
</tr>
<tr>
<td valign="top" align="center">Cortexillin</td>
<td valign="middle" align="center">EHI_104560</td>
</tr>
<tr>
<td valign="top" align="center">Coronin 1/CRN12a</td>
<td valign="middle" align="center">EHI_083590</td>
</tr>
<tr>
<td valign="top" align="center">Coronin 2/CRN12b</td>
<td valign="middle" align="center">EHI_105330</td>
</tr>
<tr>
<td valign="top" align="center">&#x3b1;-actinin1</td>
<td valign="middle" align="center">EHI_146140/EHI_164430</td>
</tr>
<tr>
<td valign="top" align="center">Filopodin</td>
<td valign="middle" align="center">EHI_080740</td>
</tr>
<tr>
<td valign="top" align="center">LimD</td>
<td valign="middle" align="center">EHI_194520</td>
</tr>
<tr>
<td valign="top" align="center">EhLIM-A</td>
<td valign="middle" align="center">EHI_096420</td>
</tr>
<tr>
<td valign="top" align="center">LimC</td>
<td valign="middle" align="center">EHI_110280</td>
</tr>
<tr>
<td valign="top" align="center">Actin-binding Rho-activating protein</td>
<td valign="middle" align="center">EHI_187110</td>
</tr>
<tr>
<td valign="top" align="center">F-actin bunding C-domain</td>
<td valign="middle" align="center">EHI_189930/EHI_103860/EHI_004550/EHI_086690/EHI_010570</td>
</tr>
<tr>
<td valign="top" align="center">TolA</td>
<td valign="middle" align="center">EHI_159620</td>
</tr>
<tr>
<td valign="top" align="center">TolA-like</td>
<td valign="middle" align="center">EHI_052780</td>
</tr>
<tr>
<td valign="top" align="center">Rab2C</td>
<td valign="middle" align="center">EHI_067850</td>
</tr>
<tr>
<td valign="top" align="center">RabC3</td>
<td valign="middle" align="center">EHI_143650</td>
</tr>
<tr>
<td valign="top" align="center">Rab1A</td>
<td valign="middle" align="center">EHI_108610</td>
</tr>
<tr>
<td valign="top" align="center">RabX11</td>
<td valign="middle" align="center">EHI_177520</td>
</tr>
<tr>
<td valign="top" align="center">RabC1</td>
<td valign="middle" align="center">EHI_153690</td>
</tr>
<tr>
<td valign="top" align="center">Rab GDP dissociation inhibitor</td>
<td valign="middle" align="center">EHI_167060</td>
</tr>
<tr>
<td valign="top" align="center">Rho GTPase</td>
<td valign="middle" align="center">EHI_129750</td>
</tr>
<tr>
<td valign="top" align="center">Ras GTPase</td>
<td valign="middle" align="center">EHI_058090</td>
</tr>
<tr>
<td valign="top" align="center">&#x3b1;-Tubulin</td>
<td valign="middle" align="center">EHI_010530</td>
</tr>
</tbody>
</table>
<table-wrap-foot>
<fn>
<p>Trophozoite proteins were immunoprecipitated with &#x3b1;-EhVps35 antibodies. The EhVps35-bound proteins were identified by mass spectrometry. Comparative analysis with previous proteomic analyses of the actin cytoskeleton was performed (<xref ref-type="bibr" rid="B41">Manich et&#xa0;al., 2018</xref>; <xref ref-type="bibr" rid="B59">Rath and Gourinath, 2020</xref>).</p>
</fn>
</table-wrap-foot>
</table-wrap>
<p>Finally, to examine the importance of the EhVps35 in phagocytosis, for its role in surface protein recycling and the actin cytoskeleton structure required for this event, the adhesion efficiency and the rate of phagocytosis were evaluated using the silenced trophozoites. The results showed a decrease of 50%&#x2013;63% in the adhesion efficiency and 53%&#x2013;61% in the rate of phagocytosis in <italic>Ehvps35</italic>-KD trophozoites at 5 and 30&#xa0;min, respectively, with respect to the results of the control trophozoites, which were taken as 100% (<xref ref-type="fig" rid="f11">
<bold>Figures&#xa0;11A, B</bold>
</xref>). These results strengthened the assumption that the EhVps35 protein is involved in the phagocytosis of trophozoites, probably due to its active participation in protein recycling and in the structuring of the actin cytoskeleton.</p>
<fig id="f11" position="float">
<label>Figure&#xa0;11</label>
<caption>
<p>Reduction in the phagocytosis rate of <italic>Ehvps35</italic> knockdown (<italic>Ehvps35</italic>-KD) trophozoites. Novikoff-stained trophozoites after 5 and 30&#xa0;min of incubation with red blood cells (RBCs) in non-silenced (control) and silenced (<italic>Ehvps35</italic>-KD) trophozoites. <bold>(A, B)</bold> RBC adherence (4&#xb0;C) and phagocytosis (37&#xb0;C), respectively. On the <italic>right of each image</italic>, the mean of the number of attached and ingested RBCs by trophozoites counted in 100 randomly chosen trophozoites in three independent experiments is shown. **<italic>p</italic> &lt; 0.01.</p>
</caption>
<graphic mimetype="image" mime-subtype="tiff" xlink:href="fpara-03-1356601-g011.tif"/>
</fig>
</sec>
</sec>
<sec id="s4" sec-type="discussion">
<label>4</label>
<title>Discussion</title>
<p>The retromer has been widely studied in humans due to its involvement in neurodegenerative diseases (<xref ref-type="bibr" rid="B74">Zhang et&#xa0;al., 2018</xref>). However, in parasitic protozoan, further research has yet to be conducted to determine whether this protein complex participates in virulence events and, therefore, whether it is a target to defeat parasites. In <italic>T. gondii</italic>, the retromer is crucial for the biogenesis of secretory organelles and to maintain the morphology of parasites; thus, several authors agree in the fact that the retromer indeed participates in <italic>T. gondii</italic> virulence (<xref ref-type="bibr" rid="B61">Sangar&#xe9; et&#xa0;al., 2016</xref>; <xref ref-type="bibr" rid="B22">Gras et&#xa0;al., 2019</xref>). In the case of <italic>E. histolytica</italic>, there are reports suggesting that the retromer is involved in phagocytosis, an important virulence mechanism in this parasite (<xref ref-type="bibr" rid="B51">Nakada-Tsukui et&#xa0;al., 2005</xref>; <xref ref-type="bibr" rid="B64">Srivastava et&#xa0;al., 2017</xref>; <xref ref-type="bibr" rid="B70">Watanabe et&#xa0;al., 2020</xref>). The retromer in these protozoa differs from the canonical one, described in yeast and mammals. The main differences are that, in both protozoa, the SNX-BAR is absent, which suggests that the membrane remodeling mechanisms in these parasites could differ from those of the classical pathway (<xref ref-type="fig" rid="f1">
<bold>Figure&#xa0;1A</bold>
</xref>) (<xref ref-type="bibr" rid="B51">Nakada-Tsukui et&#xa0;al., 2005</xref>; <xref ref-type="bibr" rid="B35">Koumandou et&#xa0;al., 2011</xref>; <xref ref-type="bibr" rid="B61">Sangar&#xe9; et&#xa0;al., 2016</xref>; <xref ref-type="bibr" rid="B70">Watanabe et&#xa0;al., 2020</xref>). More knowledge is needed on the characteristics and function of each of the elements that construct the protozoan retromer to reveal their participation in cellular functions, particularly in virulence. This knowledge will also help in understanding the evolutionary process that this conserved complex has gone through.</p>
<p>In this paper, we have studied the structure and function of the EhVps35 protein, the core of the CSC complex, as it binds EhVps29 and EhVps26, maintaining the complex and allowing the retromer function. Our work is relevant to the advance of the knowledge of the <italic>E. histolytica</italic> retromer as:</p>
<list list-type="simple">
<list-item>
<p>i. It presented data on the EhVps35 3D model;</p>
</list-item>
<list-item>
<p>ii. It provided evidence on the interaction of the retromer with the EhADH and Gal/GalNac lectin and actin proteins;</p>
</list-item>
<list-item>
<p>iii. It provided experimental evidence that the <italic>E. histolytica</italic> retromer carries out surface protein recycling and that EhVps35 is necessary to carry out this function;</p>
</list-item>
<list-item>
<p>iv. It showed that EhVps35 recycles two highly involved proteins in the host&#x2013;parasite relationship: the EhADH adhesin (<xref ref-type="bibr" rid="B1">Arroyo and Orozco, 1987</xref>; <xref ref-type="bibr" rid="B19">Garc&#xed;a-Rivera et&#xa0;al., 1999</xref>; <xref ref-type="bibr" rid="B3">Ba&#xf1;uelos et&#xa0;al., 2012</xref>) and the Gal/GalNac lectin (<xref ref-type="bibr" rid="B16">Frederick and Petri, 2005</xref>);</p>
</list-item>
<list-item>
<p>v. It provided data on the influence of EhVps35 on the structuring of the actin cytoskeleton during phagocytosis, providing further experimental data on phagocytosis being carried out by a concatenated chain of events in which several molecules participate, including EhADH, an accessory protein of the ESCRT machinery; and</p>
</list-item>
<list-item>
<p>vi. The data presented here strongly support the retromeric proteins also participating in phagocytosis. The knockdown of the <italic>Ehvps35</italic> gene revealed that, when one of the elements of phagocytosis is altered, the whole event is disrupted.</p>
</list-item>
</list>
<p>The main function of the retromer is the protein recycling from the endosomes to the <italic>trans</italic>-Golgi apparatus and the plasma membrane after selection of the internalized proteins. Thus, although its presence in the plasma membrane was not surprising, as it occurs with other retromeric proteins in mammals (<xref ref-type="bibr" rid="B33">Kerr et&#xa0;al., 2005</xref>), the presence of EhVps35 in the outer plasma membrane is intriguing because there is no information on its function in this location. More experimental data are needed to investigate whether the retromer acts together with other molecules from the first contact of the trophozoite with the target cell.</p>
<p>The knockdown of the <italic>Ehvps35</italic> gene (<italic>Ehvps35</italic>-KD) in trophozoites presented interesting results on the role of this protein, not only in protein recycling but also during the process of phagocytosis. The adhesion efficiency and the rate of phagocytosis were reduced in <italic>Ehvps35</italic>-KD trophozoites, possibly due to the absence of the EhVps35 protein, which caused a decrease in the EhADH and Gal/GalNac recycling. However, we cannot discard gene expression coordination of the chain links involved in phagocytosis. This is an assumption based on the work of <xref ref-type="bibr" rid="B53">Oc&#xe1;diz-Ruiz et&#xa0;al. (2016)</xref>, where it was found that silencing of the EhADH gene affects the expression of EhCP112 and <italic>vice versa</italic>. Moreover, EhADH is a scaffold protein; therefore, impairment in its localization could affect the recruitment of other proteins necessary for phagocytosis (<xref ref-type="bibr" rid="B1">Arroyo and Orozco, 1987</xref>; <xref ref-type="bibr" rid="B19">Garc&#xed;a-Rivera et&#xa0;al., 1999</xref>; <xref ref-type="bibr" rid="B16">Frederick and Petri, 2005</xref>; <xref ref-type="bibr" rid="B3">Ba&#xf1;uelos et&#xa0;al., 2012</xref>; <xref ref-type="bibr" rid="B2">Avalos-Padilla et&#xa0;al., 2015</xref>; <xref ref-type="bibr" rid="B18">Galindo et&#xa0;al., 2021</xref>). In addition, our results showed that EhVps35 co-localized with EhADH and F-actin in the early and late stages of phagocytosis. As a consequence, <italic>Ehvps35</italic>-KD trophozoites showed less ability to form phagocytic cups and channels. This event may be related to the decrease in actin exhibited by the CHX-treated trophozoites. This could be due to: i) the ligand attachment to the Gal/GalNac lectin in the plasma membrane, triggering a series of events including cytoskeletal reorganization and signal transduction, hence producing, in <italic>Ehvps35</italic>-KD trophozoites with less Gal/GalNac lectin, an actin disruption (<xref ref-type="bibr" rid="B43">Marion et&#xa0;al., 2004</xref>; <xref ref-type="bibr" rid="B45">McCoy and Mann, 2005</xref>; <xref ref-type="bibr" rid="B48">Meza et&#xa0;al., 2006</xref>; <xref ref-type="bibr" rid="B13">Emmanuel et&#xa0;al., 2015</xref>); ii) the CHX treatment in these trophozoites could quickly activate signaling mediated by proteins of the Rho family, which regulates the structuring and degradation of actin (<xref ref-type="bibr" rid="B23">Guild et&#xa0;al., 2002</xref>; <xref ref-type="bibr" rid="B11">Darvishi and Woldemichael, 2016</xref>); or iii) the poor interaction between EhVps35 and EhSNX1, which could have caused the EhSNX1protein to not bind to the initiator of actin polymerization (AP2/3) (<xref ref-type="bibr" rid="B70">Watanabe et&#xa0;al., 2020</xref>), strongly suggesting that the <italic>E. histolytica</italic> retromer is essential for the organization of the actin cytoskeleton. In fact, this has been suggested for other organisms (<xref ref-type="bibr" rid="B25">Harbour et&#xa0;al., 2010</xref>; <xref ref-type="bibr" rid="B46">McGough et&#xa0;al., 2014</xref>; <xref ref-type="bibr" rid="B72">Zavodszky et&#xa0;al., 2014</xref>). Furthermore, 33 actin cytoskeletal proteins directly or indirectly bound to EhVps35 were identified by mass spectrometry (<xref ref-type="table" rid="T1">
<bold>Table&#xa0;1</bold>
</xref>).</p>
<p>The decrease of EhVps35 caused poor acidification of the endosomes (<xref ref-type="fig" rid="f9">
<bold>Figure&#xa0;9</bold>
</xref>), which could lead to a decreased rate of phagocytosis. In <italic>S</italic>. <italic>cerevisiae</italic>, <italic>Drosophila melanogaster</italic>, and <italic>Dictyostelium discoideum</italic>, the retromer is vital for the lysosomal pathway as this complex recycles the V-ATPase subunit, a complex responsible for regulating cell acidification (<xref ref-type="bibr" rid="B6">Carnell et&#xa0;al., 2011</xref>; <xref ref-type="bibr" rid="B14">Finnigan et&#xa0;al., 2011</xref>; <xref ref-type="bibr" rid="B44">Maruzs et&#xa0;al., 2015</xref>; <xref ref-type="bibr" rid="B71">Ye et&#xa0;al., 2020</xref>). <xref ref-type="bibr" rid="B21">Gilmartin et&#xa0;al. (2017)</xref> demonstrated that, when ATPase activity was inhibited, the rate of phagocytosis in <italic>E. histolytica</italic> decreased. Furthermore, it has also been reported that EhVps26 and EhVps29 mutant trophozoites showed a decrease in CP activity, proteins that require acidic structures to be functional (<xref ref-type="bibr" rid="B51">Nakada-Tsukui et&#xa0;al., 2005</xref>; <xref ref-type="bibr" rid="B64">Srivastava et&#xa0;al., 2017</xref>).</p>
<p>In conclusion, our work provides an overview on the complex interactions between EhVps35, EhADH, Gal/GalNac, and actin during protein transport to different compartments in the phagocytosis of <italic>E. histolytica</italic> (<xref ref-type="fig" rid="f12">
<bold>Figure&#xa0;12</bold>
</xref>). This primitive protozoan is an excellent model for studying vesicular transport to further explore the retromer functions in phagocytosis and other virulence mechanisms. In addition, the roles of EhVps35 in protein recycling and in <italic>E. histolytica</italic> phagocytosis will reveal new targets for anti-amoebiasis drug design.</p>
<fig id="f12" position="float">
<label>Figure&#xa0;12</label>
<caption>
<p>Working model of the involvement of EhVps35 in EhADH and Gal/GalNac recycling in phagocytosis and in actin cytoskeleton structuring. (<italic>1</italic>) Adhesion of RBCs to trophozoites produced cellular signaling for phagocytic cup formation with the recruitment of several proteins, including EhVps35, EhADH, Gal/GalNac, and SNX1. (<italic>2</italic>) Phagocytic cup formation in the presence of the initiator of actin polymerization (AP2/3) during interaction with SNX1, EhVps26, and EhVps35. (<italic>3</italic>) EhVps35 in phagosomes in white intricate arrangements (WIA) in the phagosomes, probably selecting the proteins that will be recycled. (<italic>4</italic>) Recycling of the vesicle toward the plasma membrane, which carries the EhADH and Gal/GalNac proteins. (<italic>5</italic>) EhVps35 in lysosomes.</p>
</caption>
<graphic mimetype="image" mime-subtype="tiff" xlink:href="fpara-03-1356601-g012.tif"/>
</fig>
</sec>
<sec id="s5" sec-type="data-availability">
<title>Data availability statement</title>
<p>The datasets presented in this study can be found in online repositories. The names of the repository/repositories and accession number(s) can be found below: <uri xlink:href="https://www.uniprot.org/">https://www.uniprot.org/</uri>, Q96QK1; <uri xlink:href="https://www.uniprot.org/">https://www.uniprot.org/</uri>, P34110; <uri xlink:href="https://www.uniprot.org/">https://www.uniprot.org/</uri>, C4M8Z4; <uri xlink:href="https://www.uniprot.org/">https://www.uniprot.org/</uri>, C4M4G0; <uri xlink:href="https://www.uniprot.org/">https://www.uniprot.org/</uri>, A0A8U0WP17; <uri xlink:href="https://www.uniprot.org/">https://www.uniprot.org/</uri>, C4LWG4; <uri xlink:href="https://www.uniprot.org/">https://www.uniprot.org/</uri>, C4M3E8; <uri xlink:href="https://www.uniprot.org/">https://www.uniprot.org/</uri>, Q7X659; <uri xlink:href="https://www.uniprot.org/">https://www.uniprot.org/</uri>, F4I0P8; <uri xlink:href="https://www.uniprot.org/">https://www.uniprot.org/</uri>, A8R7K9; <uri xlink:href="https://www.uniprot.org/">https://www.uniprot.org/</uri>, Q8IIQ6; <uri xlink:href="https://www.uniprot.org/">https://www.uniprot.org/</uri>, S7USD8; <uri xlink:href="https://www.uniprot.org/">https://www.uniprot.org/</uri>, Q38C17; <uri xlink:href="https://www.uniprot.org/">https://www.uniprot.org/</uri>, Q6Y0Y2.</p>
</sec>
<sec id="s6" sec-type="ethics-statement">
<title>Ethics statement</title>
<p>The human samples used in this study were acquired from primarily isolated as part of your previous study for which ethical approval was obtained. Written informed consent for participation was not required from the participants or the participants&#x2019; legal guardians/next of kin in accordance with the national legislation and institutional requirements.</p>
</sec>
<sec id="s7" sec-type="author-contributions">
<title>Author contributions</title>
<p>JD: Conceptualization, Writing &#x2013; original draft, Investigation, Methodology. RJ: Supervision, Writing &#x2013; original draft, Methodology. SM: Writing &#x2013; original draft, Methodology, Software. DT: Writing &#x2013; original draft, Methodology. EO: Conceptualization, Funding acquisition, Supervision, Writing &#x2013; original draft, Writing &#x2013; review &amp; editing.</p>
</sec>
</body>
<back>
<sec id="s8" sec-type="funding-information">
<title>Funding</title>
<p>The author(s) declare that no financial support was received for the research, authorship, and/or publication of this article.</p>
</sec>
<ack>
<title>Acknowledgments</title>
<p>We are grateful to Zootechnical Veterinary Doctor Benjamin Emmanuel Ch&#xe1;vez Alvarez for his support in the inoculation techniques in laboratory animals. Additionally, we thank Emmanuel Rios Castro from the Proteomics Unit of LaNSE (Laboratorio Nacional de Servicios Experimentales) at CINVESTAV for his support technical in mass spectrometry analysis.</p>
</ack>
<sec id="s9" sec-type="COI-statement">
<title>Conflict of interest</title>
<p>The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.</p>
</sec>
<sec id="s10" sec-type="disclaimer">
<title>Publisher&#x2019;s note</title>
<p>All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.</p>
</sec>
<ref-list>
<title>References</title>
<ref id="B1">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Arroyo</surname> <given-names>R.</given-names>
</name>
<name>
<surname>Orozco</surname> <given-names>E.</given-names>
</name>
</person-group> (<year>1987</year>). <article-title>Localization and identification of an Entamoeba histolytica adhesin</article-title>. <source>Mol. Biochem. Parasitol.</source> <volume>23</volume>, <fpage>151</fpage>&#x2013;<lpage>158</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1016/0166-6851(87)90150-2</pub-id>
</citation>
</ref>
<ref id="B2">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Avalos-Padilla</surname> <given-names>Y.</given-names>
</name>
<name>
<surname>Betanzos</surname> <given-names>A.</given-names>
</name>
<name>
<surname>Javier-Reyna</surname> <given-names>R.</given-names>
</name>
<name>
<surname>Garc&#xed;a-Rivera</surname> <given-names>G.</given-names>
</name>
<name>
<surname>Ch&#xe1;vez-Mungu&#xed;a</surname> <given-names>B.</given-names>
</name>
<name>
<surname>Lagunes-Guill&#xe9;n</surname> <given-names>A.</given-names>
</name>
<etal/>
</person-group>. (<year>2015</year>). <article-title>EhVps32 is a vacuole-associated protein involved in pinocytosis and phagocytosis of Entamoeaba histolytica</article-title>. <source>PloS Pathog.</source> <volume>11</volume>, <elocation-id>e1005079</elocation-id>. doi:&#xa0;<pub-id pub-id-type="doi">10.1371/journal.ppat.1005079</pub-id>
</citation>
</ref>
<ref id="B3">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Ba&#xf1;uelos</surname> <given-names>C.</given-names>
</name>
<name>
<surname>Garc&#xed;a-Rivera</surname> <given-names>G.</given-names>
</name>
<name>
<surname>L&#xf3;pez-Reyes</surname> <given-names>I.</given-names>
</name>
<name>
<surname>Mendoza</surname> <given-names>L.</given-names>
</name>
<name>
<surname>Gonz&#xe1;lez-Robles</surname> <given-names>A.</given-names>
</name>
<name>
<surname>Herranz</surname> <given-names>S.</given-names>
</name>
<etal/>
</person-group>. (<year>2012</year>). <article-title>EhADH112 Is a Bro1 domain-containing protein involved in the entamoeba histolytica multivesicular bodies pathway</article-title>. <source>J. BioMed. Biotechnol.</source> <volume>2012</volume>, <page-range>1&#x2013;15</page-range>. doi:&#xa0;<pub-id pub-id-type="doi">10.1155/2012/657942</pub-id>
</citation>
</ref>
<ref id="B4">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Biller</surname> <given-names>L.</given-names>
</name>
<name>
<surname>Matthiesen</surname> <given-names>J.</given-names>
</name>
<name>
<surname>K&#xfc;hne</surname> <given-names>V.</given-names>
</name>
<name>
<surname>Lotter</surname> <given-names>H.</given-names>
</name>
<name>
<surname>Handal</surname> <given-names>G.</given-names>
</name>
<name>
<surname>Nozaki</surname> <given-names>T.</given-names>
</name>
<etal/>
</person-group>. (<year>2014</year>). <article-title>The cell surface proteome of Entamoeba histolytica</article-title>. <source>Mol. Cell Proteomics</source> <volume>13</volume>, <fpage>132</fpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1074/mcp.M113.031393</pub-id>
</citation>
</ref>
<ref id="B5">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Bonifacino</surname> <given-names>J. S.</given-names>
</name>
<name>
<surname>Hurley</surname> <given-names>J. H.</given-names>
</name>
</person-group> (<year>2008</year>). <article-title>Retromer</article-title>. <source>Curr. Opin. Cell Biol.</source> <volume>20</volume>, <fpage>427</fpage>&#x2013;<lpage>436</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1016/j.ceb.2008.03.009</pub-id>
</citation>
</ref>
<ref id="B6">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Carnell</surname> <given-names>M.</given-names>
</name>
<name>
<surname>Zech</surname> <given-names>T.</given-names>
</name>
<name>
<surname>Calaminus</surname> <given-names>S. D.</given-names>
</name>
<name>
<surname>Ura</surname> <given-names>S.</given-names>
</name>
<name>
<surname>Hagedorn</surname> <given-names>M.</given-names>
</name>
<name>
<surname>Johnston</surname> <given-names>S. A.</given-names>
</name>
<etal/>
</person-group>. (<year>2011</year>). <article-title>Actin polymerization driven by WASH causes V-ATPase retrieval and vesicle neutralization before exocytosis</article-title>. <source>J. Cell Biol.</source> <volume>193</volume>, <fpage>831</fpage>&#x2013;<lpage>839</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1083/jcb.201009119</pub-id>
</citation>
</ref>
<ref id="B7">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Castellanos-Castro</surname> <given-names>S.</given-names>
</name>
<name>
<surname>Cerda-Garc&#xed;a-Rojas</surname> <given-names>C. M.</given-names>
</name>
<name>
<surname>Javier-Reyna</surname> <given-names>R.</given-names>
</name>
<name>
<surname>Pais-Morales</surname> <given-names>J.</given-names>
</name>
<name>
<surname>Ch&#xe1;vez-Mungu&#xed;a</surname> <given-names>B.</given-names>
</name>
<name>
<surname>Orozco</surname> <given-names>E.</given-names>
</name>
</person-group> (<year>2016</year>). <article-title>Identification of the phospholipid lysobisphosphatidic acid in the protozoan Entamoeba histolytica: An active molecule in endocytosis</article-title>. <source>Biochem. Biophys. Rep.</source> <volume>5</volume>, <fpage>224</fpage>&#x2013;<lpage>236</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1016/j.bbrep.2015.12.010</pub-id>
</citation>
</ref>
<ref id="B8">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Comeau</surname> <given-names>S. R.</given-names>
</name>
<name>
<surname>Gatchell</surname> <given-names>D. W.</given-names>
</name>
<name>
<surname>Vajda</surname> <given-names>S.</given-names>
</name>
<name>
<surname>Camacho</surname> <given-names>C. J.</given-names>
</name>
</person-group> (<year>2004</year>). <article-title>ClusPro: an automated docking and discrimination method for the prediction of protein complexes</article-title>. <source>Bioinformatics</source> <volume>20</volume>, <fpage>45</fpage>&#x2013;<lpage>50</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1093/bioinformatics/btg371</pub-id>
</citation>
</ref>
<ref id="B9">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Cui</surname> <given-names>Y.</given-names>
</name>
<name>
<surname>Carosi</surname> <given-names>J. M.</given-names>
</name>
<name>
<surname>Yang</surname> <given-names>Z.</given-names>
</name>
<name>
<surname>Ariotti</surname> <given-names>N.</given-names>
</name>
<name>
<surname>Kerr</surname> <given-names>M. C.</given-names>
</name>
<name>
<surname>Parton</surname> <given-names>R. G.</given-names>
</name>
<etal/>
</person-group>. (<year>2019</year>). <article-title>Retromer has a selective function in cargo sorting via endosome transport carriers</article-title>. <source>J. Cell Biol.</source> <volume>218</volume>, <fpage>615</fpage>&#x2013;<lpage>631</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1083/jcb.201806153</pub-id>
</citation>
</ref>
<ref id="B10">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Damen</surname> <given-names>E.</given-names>
</name>
<name>
<surname>Krieger</surname> <given-names>E.</given-names>
</name>
<name>
<surname>Nielsen</surname> <given-names>J. E.</given-names>
</name>
<name>
<surname>Eygensteyn</surname> <given-names>J.</given-names>
</name>
<name>
<surname>Van Leeuwen</surname> <given-names>J. E. M.</given-names>
</name>
</person-group> (<year>2006</year>). <article-title>The human Vps29 retromer component is a metallo-phosphoesterase for a cation-independent mannose 6-phosphate receptor substrate peptide</article-title>. <source>Biochem. J.</source> <volume>398</volume>, <fpage>399</fpage>&#x2013;<lpage>409</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1042/BJ20060033</pub-id>
</citation>
</ref>
<ref id="B11">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Darvishi</surname> <given-names>E.</given-names>
</name>
<name>
<surname>Woldemichael</surname> <given-names>G. M.</given-names>
</name>
</person-group> (<year>2016</year>). <article-title>Cycloheximide inhibits actin cytoskeletal dynamics by suppressing signaling via RhoA</article-title>. <source>J. Cell Biochem.</source> <volume>117</volume>, <fpage>2886</fpage>&#x2013;<lpage>2898</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1002/jcb.25601</pub-id>
</citation>
</ref>
<ref id="B12">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Diamond</surname> <given-names>L. S.</given-names>
</name>
<name>
<surname>Harlow</surname> <given-names>D. R.</given-names>
</name>
<name>
<surname>Cunnick</surname> <given-names>C. C.</given-names>
</name>
</person-group> (<year>1978</year>). <article-title>A new medium for the axenic cultivation of Entamoeba histolytica and other Entamoeba</article-title>. <source>Trans. R Soc. Trop. Med. Hyg.</source> <volume>72</volume>, <fpage>431</fpage>&#x2013;<lpage>432</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1016/0035-9203(78)90144-X</pub-id>
</citation>
</ref>
<ref id="B13">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Emmanuel</surname> <given-names>M.</given-names>
</name>
<name>
<surname>Nakano</surname> <given-names>Y. S.</given-names>
</name>
<name>
<surname>Nozaki</surname> <given-names>T.</given-names>
</name>
<name>
<surname>Datta</surname> <given-names>S.</given-names>
</name>
</person-group> (<year>2015</year>). <article-title>Small GTPase Rab21 mediates fibronectin induced actin reorganization in Entamoeba histolytica: implications in pathogen invasion</article-title>. <source>PloS Pathog.</source> <volume>11</volume>, <elocation-id>e1004666</elocation-id>. doi:&#xa0;<pub-id pub-id-type="doi">10.1371/journal.ppat.1004666</pub-id>
</citation>
</ref>
<ref id="B14">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Finnigan</surname> <given-names>G. C.</given-names>
</name>
<name>
<surname>Hanson-Smith</surname> <given-names>V.</given-names>
</name>
<name>
<surname>Houser</surname> <given-names>B. D.</given-names>
</name>
<name>
<surname>Park</surname> <given-names>H. J.</given-names>
</name>
<name>
<surname>Stevens</surname> <given-names>T. H.</given-names>
</name>
</person-group> (<year>2011</year>). <article-title>The reconstructed ancestral subunit a functions as both V-ATPase isoforms Vph1p and Stv1p in Saccharomyces cerevisiae</article-title>. <source>Mol. Biol. Cell</source> <volume>22</volume>, <fpage>3176</fpage>&#x2013;<lpage>3191</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1091/MBC.E11-03-0244/ASSET/IMAGES/LARGE/3176FIG10.JPEG</pub-id>
</citation>
</ref>
<ref id="B15">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Fjorback</surname> <given-names>A. W.</given-names>
</name>
<name>
<surname>Seaman</surname> <given-names>M.</given-names>
</name>
<name>
<surname>Gustafsen</surname> <given-names>C.</given-names>
</name>
<name>
<surname>Mehmedbasic</surname> <given-names>A.</given-names>
</name>
<name>
<surname>Gokool</surname> <given-names>S.</given-names>
</name>
<name>
<surname>Wu</surname> <given-names>C.</given-names>
</name>
<etal/>
</person-group>. (<year>2012</year>). <article-title>Retromer binds the FANSHY sorting motif in SorLA to regulate amyloid precursor protein sorting and processing</article-title>. <source>J. Neurosci.</source> <volume>32</volume>, <fpage>1467</fpage>&#x2013;<lpage>1480</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1523/JNEUROSCI.2272-11.2012</pub-id>
</citation>
</ref>
<ref id="B16">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Frederick</surname> <given-names>J. R.</given-names>
</name>
<name>
<surname>Petri</surname> <given-names>W. A.</given-names>
</name>
</person-group> (<year>2005</year>). <article-title>Roles for the galactose-/N-acetylgalactosamine-binding lectin of Entamoeba in parasite virulence and differentiation</article-title>. <source>Glycobiology</source> <volume>15</volume>, <page-range>53R&#x2013;59R</page-range>. doi:&#xa0;<pub-id pub-id-type="doi">10.1093/glycob/cwj007</pub-id>
</citation>
</ref>
<ref id="B17">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Galindo</surname> <given-names>A.</given-names>
</name>
<name>
<surname>Javier-Reyna</surname> <given-names>R.</given-names>
</name>
<name>
<surname>Garc&#xed;a-Rivera</surname> <given-names>G.</given-names>
</name>
<name>
<surname>Ba&#xf1;uelos</surname> <given-names>C.</given-names>
</name>
<name>
<surname>Ch&#xe1;vez-Mungu&#xed;a</surname> <given-names>B.</given-names>
</name>
<name>
<surname>Salazar-Villatoro</surname> <given-names>L.</given-names>
</name>
<etal/>
</person-group>. (<year>2022</year>). <article-title>EhVps23, an ESCRT-I member, is a key factor in secretion, motility, phagocytosis and tissue invasion by Entamoeba histolytica</article-title>. <source>Front. Cell Infect. Microbiol.</source> <volume>12</volume>. doi:&#xa0;<pub-id pub-id-type="doi">10.3389/fcimb.2022.835654</pub-id>
</citation>
</ref>
<ref id="B18">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Galindo</surname> <given-names>A.</given-names>
</name>
<name>
<surname>Javier-Reyna</surname> <given-names>R.</given-names>
</name>
<name>
<surname>Garc&#xed;a-Rivera</surname> <given-names>G.</given-names>
</name>
<name>
<surname>Ba&#xf1;uelos</surname> <given-names>C.</given-names>
</name>
<name>
<surname>Monta&#xf1;o</surname> <given-names>S.</given-names>
</name>
<name>
<surname>Ortega-Lopez</surname> <given-names>J.</given-names>
</name>
<etal/>
</person-group>. (<year>2021</year>). <article-title>EhVps23: A component of ESCRT-I that participates in vesicular trafficking and phagocytosis of Entamoeba histolytica</article-title>. <source>Front. Cell Infect. Microbiol.</source> <volume>11</volume>. doi:&#xa0;<pub-id pub-id-type="doi">10.3389/fcimb.2021.770759</pub-id>
</citation>
</ref>
<ref id="B19">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Garc&#xed;a-Rivera</surname> <given-names>G.</given-names>
</name>
<name>
<surname>Rodr&#xed;guez</surname> <given-names>M. A.</given-names>
</name>
<name>
<surname>Oc&#xe1;diz</surname> <given-names>R.</given-names>
</name>
<name>
<surname>Mart&#xed;nez-L&#xf3;pez</surname> <given-names>M. C.</given-names>
</name>
<name>
<surname>Arroyo</surname> <given-names>R.</given-names>
</name>
<name>
<surname>Gonz&#xe1;lez-Robles</surname> <given-names>A.</given-names>
</name>
<etal/>
</person-group>. (<year>1999</year>). <article-title>Entamoeba histolytica: a novel cysteine protease and an adhesin form the 112 kDa surface protein</article-title>. <source>Mol. Microbiol.</source> <volume>33</volume>, <fpage>556</fpage>&#x2013;<lpage>568</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1046/J.1365-2958.1999.01500.X</pub-id>
</citation>
</ref>
<ref id="B20">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Garc&#xed;a-Rivera</surname> <given-names>G.</given-names>
</name>
<name>
<surname>S&#xe1;nchez</surname> <given-names>T.</given-names>
</name>
<name>
<surname>Orozco</surname> <given-names>E.</given-names>
</name>
<name>
<surname>Guarneros</surname> <given-names>G.</given-names>
</name>
</person-group> (<year>1982</year>). <article-title>Isolation of clones of E. histolytica deficient in adhesion to human erythrocytes</article-title>. <source>Arch. Invest. Med. (Mex.)</source> <volume>13</volume>, <fpage>129</fpage>&#x2013;<lpage>136</lpage>.</citation>
</ref>
<ref id="B21">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Gilmartin</surname> <given-names>A. A.</given-names>
</name>
<name>
<surname>Ralston</surname> <given-names>K. S.</given-names>
</name>
<name>
<surname>Petri</surname> <given-names>W. A., Jr.</given-names>
</name>
</person-group> (<year>2017</year>). <article-title>Inhibition of Amebic Lysosomal Acidification Blocks Amebic Trogocytosis and Cell Killing</article-title>. <source>mBio</source>, <volume>8</volume> (<issue>4</issue>), <fpage>e01187</fpage>&#x2013;<lpage>e011817</lpage>. doi: <pub-id pub-id-type="doi">10.1128/mBio.01187-17</pub-id>
</citation>
</ref>
<ref id="B22">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Gras</surname> <given-names>S.</given-names>
</name>
<name>
<surname>Jimenez-Ruiz</surname> <given-names>E.</given-names>
</name>
<name>
<surname>Klinger</surname> <given-names>C. M.</given-names>
</name>
<name>
<surname>Schneider</surname> <given-names>K.</given-names>
</name>
<name>
<surname>Klingl</surname> <given-names>A.</given-names>
</name>
<name>
<surname>Lemgruber</surname> <given-names>L.</given-names>
</name>
<etal/>
</person-group>. (<year>2019</year>). <article-title>An endocytic-secretory cycle participates in Toxoplasma gondii in motility</article-title>. <source>PloS Biol.</source> <volume>17</volume>, <elocation-id>e3000060</elocation-id>. doi:&#xa0;<pub-id pub-id-type="doi">10.1371/journal.pbio.3000060</pub-id>
</citation>
</ref>
<ref id="B23">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Guild</surname> <given-names>G. M.</given-names>
</name>
<name>
<surname>Connelly</surname> <given-names>p. S.</given-names>
</name>
<name>
<surname>Vranich</surname> <given-names>K. A.</given-names>
</name>
<name>
<surname>Shaw</surname> <given-names>M. K.</given-names>
</name>
<name>
<surname>Tilney</surname> <given-names>L. G.</given-names>
</name>
</person-group> (<year>2002</year>). <article-title>Actin filament turnover removes bundles from Drosophila bristle cells</article-title>. <source>J. Cell Sci.</source> <volume>115</volume>, <fpage>641</fpage>&#x2013;<lpage>653</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1242/jcs.115.3.641</pub-id>
</citation>
</ref>
<ref id="B24">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Haft</surname> <given-names>C. R.</given-names>
</name>
<name>
<surname>de la Luz Sierra</surname> <given-names>M.</given-names>
</name>
<name>
<surname>Bafford</surname> <given-names>R.</given-names>
</name>
<name>
<surname>Lesniak</surname> <given-names>M. A.</given-names>
</name>
<name>
<surname>Barr</surname> <given-names>V. A.</given-names>
</name>
<name>
<surname>Taylor</surname> <given-names>S. I.</given-names>
</name>
</person-group> (<year>2000</year>). <article-title>Human orthologs of yeast vacuolar protein sorting proteins Vps26, 29, and 35: Assembly into multimeric complexes</article-title>. <source>Mol. Biol. Cell</source> <volume>11</volume>, <fpage>4105</fpage>&#x2013;<lpage>4116</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1091/mbc.11.12.4105</pub-id>
</citation>
</ref>
<ref id="B25">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Harbour</surname> <given-names>M. E.</given-names>
</name>
<name>
<surname>Breusegem</surname> <given-names>S. Y. A.</given-names>
</name>
<name>
<surname>Antrobus</surname> <given-names>R.</given-names>
</name>
<name>
<surname>Freeman</surname> <given-names>C.</given-names>
</name>
<name>
<surname>Reid</surname> <given-names>E.</given-names>
</name>
<name>
<surname>Seaman</surname> <given-names>M. N. J.</given-names>
</name>
</person-group> (<year>2010</year>). <article-title>The cargo-selective retromer complex is a recruiting hub for protein complexes that regulate endosomal tubule dynamics</article-title>. <source>J. Cell Sci.</source> <volume>123</volume>, <fpage>3703</fpage>&#x2013;<lpage>3717</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1242/jcs.071472</pub-id>
</citation>
</ref>
<ref id="B26">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Hashiguchi</surname> <given-names>Y.</given-names>
</name>
<name>
<surname>Niihama</surname> <given-names>M.</given-names>
</name>
<name>
<surname>Takahashi</surname> <given-names>T.</given-names>
</name>
<name>
<surname>Saito</surname> <given-names>C.</given-names>
</name>
<name>
<surname>Nakano</surname> <given-names>A.</given-names>
</name>
<name>
<surname>Tasaka</surname> <given-names>M.</given-names>
</name>
<etal/>
</person-group>. (<year>2012</year>). <article-title>Loss-of-function mutations of retromer large subunit genes suppress the phenotype of an Arabidopsis zig mutant that lacks Qb-SNARE VTI11</article-title>. <source>Plant Cell</source> <volume>22</volume>, <fpage>159</fpage>&#x2013;<lpage>172</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1105/tpc.109.069294</pub-id>
</citation>
</ref>
<ref id="B27">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Hierro</surname> <given-names>A.</given-names>
</name>
<name>
<surname>Rojas</surname> <given-names>A. L.</given-names>
</name>
<name>
<surname>Rojas</surname> <given-names>R.</given-names>
</name>
<name>
<surname>Murthy</surname> <given-names>N.</given-names>
</name>
<name>
<surname>Effantin</surname> <given-names>G.</given-names>
</name>
<name>
<surname>Kajava</surname> <given-names>A. V.</given-names>
</name>
<etal/>
</person-group>. (<year>2007</year>). <article-title>Functional architecture of the retromer cargo-recognition complex</article-title>. <source>Nature</source> <volume>449</volume>, <fpage>1063</fpage>&#x2013;<lpage>1067</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1038/nature06216</pub-id>
</citation>
</ref>
<ref id="B28">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Huang</surname> <given-names>J.</given-names>
</name>
<name>
<surname>Mackerell</surname> <given-names>A. D.</given-names>
</name>
</person-group> (<year>2013</year>). <article-title>CHARMM36 all-atom additive protein force field: Validation based on comparison to NMR data</article-title>. <source>J. Comput. Chem.</source> <volume>34</volume>, <fpage>2135</fpage>&#x2013;<lpage>2145</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1002/jcc.23354</pub-id>
</citation>
</ref>
<ref id="B29">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Huang</surname> <given-names>Y.</given-names>
</name>
<name>
<surname>Huang</surname> <given-names>H.</given-names>
</name>
<name>
<surname>Zhou</surname> <given-names>L.</given-names>
</name>
<name>
<surname>Li</surname> <given-names>J.</given-names>
</name>
<name>
<surname>Chen</surname> <given-names>X.</given-names>
</name>
<name>
<surname>Thomas</surname> <given-names>J.</given-names>
</name>
<etal/>
</person-group>. (<year>2022</year>). <article-title>Mutant VPS35-D620N induces motor dysfunction and impairs DAT-mediated dopamine recycling pathway</article-title>. <source>Hum. Mol. Genet.</source> <volume>31</volume>, <fpage>3886</fpage>&#x2013;<lpage>3896</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1093/hmg/ddac142</pub-id>
</citation>
</ref>
<ref id="B30">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Humphrey</surname> <given-names>W.</given-names>
</name>
<name>
<surname>Dalke</surname> <given-names>A.</given-names>
</name>
<name>
<surname>Schulten</surname> <given-names>K.</given-names>
</name>
</person-group> (<year>1996</year>). <article-title>VMD: Visual molecular dynamics</article-title>. <source>J. Mol. Graph</source> <volume>14</volume>, <fpage>33</fpage>&#x2013;<lpage>38</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1016/0263-7855(96)00018-5</pub-id>
</citation>
</ref>
<ref id="B31">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Ivaska</surname> <given-names>J.</given-names>
</name>
<name>
<surname>Whelan</surname> <given-names>R. D. H.</given-names>
</name>
<name>
<surname>Watson</surname> <given-names>R.</given-names>
</name>
<name>
<surname>Parker</surname> <given-names>P. J.</given-names>
</name>
</person-group> (<year>2002</year>). <article-title>PKC epsilon controls the traffic of beta1 integrins in motile cells</article-title>. <source>EMBO J.</source> <volume>21</volume>, <fpage>3608</fpage>&#x2013;<lpage>3619</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1093/emboj/cdf371</pub-id>
</citation>
</ref>
<ref id="B32">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Jaillais</surname> <given-names>Y.</given-names>
</name>
<name>
<surname>Santambrogio</surname> <given-names>M.</given-names>
</name>
<name>
<surname>Rozier</surname> <given-names>F.</given-names>
</name>
<name>
<surname>Fobis-Loisy</surname> <given-names>I.</given-names>
</name>
<name>
<surname>Mi&#xe8;ge</surname> <given-names>C.</given-names>
</name>
<name>
<surname>Gaude</surname> <given-names>T.</given-names>
</name>
</person-group> (<year>2007</year>). <article-title>The retromer protein VPS29 links cell polarity and organ initiation in plants</article-title>. <source>Cell</source> <volume>130</volume>, <fpage>1057</fpage>&#x2013;<lpage>1070</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1016/j.cell.2007.08.040</pub-id>
</citation>
</ref>
<ref id="B33">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Kerr</surname> <given-names>M. C.</given-names>
</name>
<name>
<surname>Bennetts</surname> <given-names>J. S.</given-names>
</name>
<name>
<surname>Simpson</surname> <given-names>F.</given-names>
</name>
<name>
<surname>Thomas</surname> <given-names>E. C.</given-names>
</name>
<name>
<surname>Flegg</surname> <given-names>C.</given-names>
</name>
<name>
<surname>Gleeson</surname> <given-names>P. A.</given-names>
</name>
<etal/>
</person-group>. (<year>2005</year>). <article-title>A novel mammalian retromer component, Vps26B</article-title>. <source>Traffic</source> <volume>6</volume>, <fpage>991</fpage>&#x2013;<lpage>1001</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1111/j.1600-0854.2005.00328.x</pub-id>
</citation>
</ref>
<ref id="B34">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Koukos</surname> <given-names>P. I.</given-names>
</name>
<name>
<surname>Glykos</surname> <given-names>N. M.</given-names>
</name>
</person-group> (<year>2013</year>). <article-title>Grcarma: A fully automated task-oriented interface for the analysis of molecular dynamics trajectories</article-title>. <source>J. Comput. Chem.</source> <volume>34</volume>, <fpage>2310</fpage>&#x2013;<lpage>2312</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1002/jcc.23381</pub-id>
</citation>
</ref>
<ref id="B35">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Koumandou</surname> <given-names>V. L.</given-names>
</name>
<name>
<surname>Klute</surname> <given-names>M. J.</given-names>
</name>
<name>
<surname>Herman</surname> <given-names>E. K.</given-names>
</name>
<name>
<surname>Nunez-Miguel</surname> <given-names>R.</given-names>
</name>
<name>
<surname>Dacks</surname> <given-names>J. B.</given-names>
</name>
<name>
<surname>Field</surname> <given-names>M. C.</given-names>
</name>
</person-group> (<year>2011</year>). <article-title>Evolutionary reconstruction of the retromer complex and its function in Trypanosoma brucei</article-title>. <source>J. Cell Sci.</source> <volume>124</volume>, <fpage>1496</fpage>&#x2013;<lpage>1509</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1242/jcs.081596</pub-id>
</citation>
</ref>
<ref id="B36">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Kozakov</surname> <given-names>D.</given-names>
</name>
<name>
<surname>Beglov</surname> <given-names>D.</given-names>
</name>
<name>
<surname>Bohnuud</surname> <given-names>T.</given-names>
</name>
<name>
<surname>Mottarella</surname> <given-names>S. E.</given-names>
</name>
<name>
<surname>Xia</surname> <given-names>B.</given-names>
</name>
<name>
<surname>Hall</surname> <given-names>D. R.</given-names>
</name>
<etal/>
</person-group>. (<year>2013</year>). <article-title>How good is automated protein docking</article-title>? <source>Proteins: Struct. Funct. Bioinf.</source> <volume>81</volume>, <fpage>2159</fpage>&#x2013;<lpage>2166</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1002/prot.24403</pub-id>
</citation>
</ref>
<ref id="B37">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Laskowski</surname> <given-names>R. A.</given-names>
</name>
<name>
<surname>Hutchinson</surname> <given-names>E. G.</given-names>
</name>
<name>
<surname>Michie</surname> <given-names>A. D.</given-names>
</name>
<name>
<surname>Wallace</surname> <given-names>A. C.</given-names>
</name>
<name>
<surname>Jones</surname> <given-names>M. L.</given-names>
</name>
<name>
<surname>Thornton</surname> <given-names>J. M.</given-names>
</name>
</person-group> (<year>1997</year>). <article-title>PDBsum: a web-based database of summaries and analyses of all PDB structures</article-title>. <source>Trends Biochem. Sci.</source> <volume>22</volume>, <fpage>488</fpage>&#x2013;<lpage>490</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1016/S0968-0004(97)01140-7</pub-id>
</citation>
</ref>
<ref id="B38">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Li</surname> <given-names>G. Z.</given-names>
</name>
<name>
<surname>Vissers</surname> <given-names>J. P. C.</given-names>
</name>
<name>
<surname>Silva</surname> <given-names>J. C.</given-names>
</name>
<name>
<surname>Golick</surname> <given-names>D.</given-names>
</name>
<name>
<surname>Gorenstein</surname> <given-names>M. V.</given-names>
</name>
<name>
<surname>Geromanos</surname> <given-names>S. J.</given-names>
</name>
</person-group> (<year>2009</year>). <article-title>Database searching and accounting of multiplexed precursor and product ion spectra from the data independent analysis of simple and complex peptide mixtures</article-title>. <source>Proteomics</source> <volume>9</volume>, <fpage>1696</fpage>&#x2013;<lpage>1719</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1002/pmic.200800564</pub-id>
</citation>
</ref>
<ref id="B39">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Liu</surname> <given-names>T. T.</given-names>
</name>
<name>
<surname>Gomez</surname> <given-names>T. S.</given-names>
</name>
<name>
<surname>Sackey</surname> <given-names>B. K.</given-names>
</name>
<name>
<surname>Billadeau</surname> <given-names>D. D.</given-names>
</name>
<name>
<surname>Burd</surname> <given-names>C. G.</given-names>
</name>
</person-group> (<year>2012</year>). <article-title>Rab GTPase regulation of retromer-mediated cargo export during endosome maturation</article-title>. <source>Mol. Biol. Cell</source> <volume>23</volume>, <fpage>2505</fpage>&#x2013;<lpage>2515</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1091/mbc.e11-11-0915</pub-id>
</citation>
</ref>
<ref id="B40">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Lucas</surname> <given-names>M.</given-names>
</name>
<name>
<surname>Gershlick</surname> <given-names>D. C.</given-names>
</name>
<name>
<surname>Vidaurrazaga</surname> <given-names>A.</given-names>
</name>
<name>
<surname>Rojas</surname> <given-names>A. L.</given-names>
</name>
<name>
<surname>Bonifacino</surname> <given-names>J. S.</given-names>
</name>
<name>
<surname>Hierro</surname> <given-names>A.</given-names>
</name>
</person-group> (<year>2016</year>). <article-title>Structural mechanism for cargo recognition by the retromer complex</article-title>. <source>Cell</source> <volume>167</volume>, <fpage>1623</fpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1016/j.cell.2016.10.056</pub-id>
</citation>
</ref>
<ref id="B41">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Manich</surname> <given-names>M.</given-names>
</name>
<name>
<surname>Hernandez-Cuevas</surname> <given-names>N.</given-names>
</name>
<name>
<surname>Ospina-Villa</surname> <given-names>J. D.</given-names>
</name>
<name>
<surname>Syan</surname> <given-names>S.</given-names>
</name>
<name>
<surname>Marchat</surname> <given-names>L. A.</given-names>
</name>
<name>
<surname>Olivo-Marin</surname> <given-names>J. C.</given-names>
</name>
<etal/>
</person-group>. (<year>2018</year>). <article-title>Morphodynamics of the actin-rich cytoskeleton in Entamoeba histolytica</article-title>. <source>Front. Cell Infect. Microbiol.</source> <volume>8</volume>. doi:&#xa0;<pub-id pub-id-type="doi">10.3389/fcimb.2018.00179</pub-id>
</citation>
</ref>
<ref id="B42">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Marion</surname> <given-names>S.</given-names>
</name>
<name>
<surname>Laurent</surname> <given-names>C.</given-names>
</name>
<name>
<surname>Guill&#xe9;n</surname> <given-names>N.</given-names>
</name>
</person-group> (<year>2005</year>). <article-title>Signalization and cytoskeleton activity through myosin IB during the early steps of phagocytosis in Entamoeba histolytica: a proteomic approach</article-title>. <source>Cell Microbiol.</source> <volume>7</volume>, <fpage>1504</fpage>&#x2013;<lpage>1518</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1111/j.1462-5822.2005.00573.x</pub-id>
</citation>
</ref>
<ref id="B43">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Marion</surname> <given-names>S.</given-names>
</name>
<name>
<surname>Tavares</surname> <given-names>P.</given-names>
</name>
<name>
<surname>Arhets</surname> <given-names>P.</given-names>
</name>
<name>
<surname>Guill&#xe9;n</surname> <given-names>N.</given-names>
</name>
</person-group> (<year>2004</year>). <article-title>Signal transduction through the Gal&#x2013;GalNAc lectin of Entamoeba histolytica involves a spectrin-like protein</article-title>. <source>Mol. Biochem. Parasitol.</source> <volume>135</volume>, <fpage>31</fpage>&#x2013;<lpage>38</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1016/j.molbiopara.2003.12.012</pub-id>
</citation>
</ref>
<ref id="B44">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Maruzs</surname> <given-names>T.</given-names>
</name>
<name>
<surname>Lorincz</surname> <given-names>P.</given-names>
</name>
<name>
<surname>Szatm&#xe1;ri</surname> <given-names>Z.</given-names>
</name>
<name>
<surname>Sz&#xe9;plaki</surname> <given-names>S.</given-names>
</name>
<name>
<surname>S&#xe1;ndor</surname> <given-names>Z.</given-names>
</name>
<name>
<surname>Lakatos</surname> <given-names>Z.</given-names>
</name>
<etal/>
</person-group>. (<year>2015</year>). <article-title>Retromer ensures the degradation of autophagic cargo by maintaining lysosome function in Drosophila</article-title>. <source>Traffic</source> <volume>16</volume>, <fpage>1088</fpage>&#x2013;<lpage>1107</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1111/tra.12309</pub-id>
</citation>
</ref>
<ref id="B45">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>McCoy</surname> <given-names>J. J.</given-names>
</name>
<name>
<surname>Mann</surname> <given-names>B. J.</given-names>
</name>
</person-group> (<year>2005</year>). <article-title>Proteomic analysis of Gal/GalNAc lectin-associated proteins in Entamoeba histolytica</article-title>. <source>Exp. Parasitol.</source> <volume>110</volume>, <fpage>220</fpage>&#x2013;<lpage>225</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1016/j.exppara.2005.02.013</pub-id>
</citation>
</ref>
<ref id="B46">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>McGough</surname> <given-names>I. J.</given-names>
</name>
<name>
<surname>Steinberg</surname> <given-names>F.</given-names>
</name>
<name>
<surname>Jia</surname> <given-names>D.</given-names>
</name>
<name>
<surname>Barbuti</surname> <given-names>P. A.</given-names>
</name>
<name>
<surname>McMillan</surname> <given-names>K. J.</given-names>
</name>
<name>
<surname>Heesom</surname> <given-names>K. J.</given-names>
</name>
<etal/>
</person-group>. (<year>2014</year>). <article-title>Retromer binding to FAM21 and the WASH complex is perturbed by the Parkinson disease-linked VPS35(D620N) mutation</article-title>. <source>Curr. Biol.</source> <volume>24</volume>, <fpage>1670</fpage>&#x2013;<lpage>1676</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1016/j.cub.2014.06.024</pub-id>
</citation>
</ref>
<ref id="B47">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>McNally</surname> <given-names>K. E.</given-names>
</name>
<name>
<surname>Faulkner</surname> <given-names>R.</given-names>
</name>
<name>
<surname>Steinberg</surname> <given-names>F.</given-names>
</name>
<name>
<surname>Gallon</surname> <given-names>M.</given-names>
</name>
<name>
<surname>Ghai</surname> <given-names>R.</given-names>
</name>
<name>
<surname>Pim</surname> <given-names>D.</given-names>
</name>
<etal/>
</person-group>. (<year>2017</year>). <article-title>Retriever is a multiprotein complex for retromer-independent endosomal cargo recycling</article-title>. <source>Nat. Cell Biol.</source> <volume>10</volume>, <fpage>1214</fpage>&#x2013;<lpage>1225</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1038/ncb3610</pub-id>
</citation>
</ref>
<ref id="B48">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Meza</surname> <given-names>I.</given-names>
</name>
<name>
<surname>Talam&#xe1;s-Rohana</surname> <given-names>P.</given-names>
</name>
<name>
<surname>Vargas</surname> <given-names>M. A.</given-names>
</name>
</person-group> (<year>2006</year>). <article-title>The cytoskeleton of Entamoeba histolytica: structure, function, and regulation by signaling pathways</article-title>. <source>Arch. Med. Res.</source> <volume>37</volume>, <fpage>234</fpage>&#x2013;<lpage>243</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1016/j.arcmed.2005.09.008</pub-id>
</citation>
</ref>
<ref id="B49">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Monta&#xf1;o</surname> <given-names>S.</given-names>
</name>
<name>
<surname>Orozco</surname> <given-names>E.</given-names>
</name>
<name>
<surname>Correa-Basurto</surname> <given-names>J.</given-names>
</name>
<name>
<surname>Bello</surname> <given-names>M.</given-names>
</name>
<name>
<surname>Ch&#xe1;vez-Mungu&#xed;a</surname> <given-names>B.</given-names>
</name>
<name>
<surname>Betanzos</surname> <given-names>A.</given-names>
</name>
</person-group> (<year>2017</year>). <article-title>Heterodimerization of the Entamoeba histolytica EhCPADH virulence complex through molecular dynamics and protein&#x2013;protein docking</article-title>. <source>J. Biomol. Struct. Dyn.</source> <volume>35</volume>, <fpage>486</fpage>&#x2013;<lpage>503</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1080/07391102.2016.1151831</pub-id>
</citation>
</ref>
<ref id="B50">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Nakada-Tsukui</surname> <given-names>K.</given-names>
</name>
<name>
<surname>Okada</surname> <given-names>H.</given-names>
</name>
<name>
<surname>Mitra</surname> <given-names>B. N.</given-names>
</name>
<name>
<surname>Nozaki</surname> <given-names>T.</given-names>
</name>
</person-group> (<year>2009</year>). <article-title>Phosphatidylinositol-phosphates mediate cytoskeletal reorganization during phagocytosis via a unique modular protein consisting of RhoGEF/DH and FYVE domains in the parasitic protozoon Entamoeba histolytica</article-title>. <source>Cell Microbiol.</source> <volume>11</volume>, <fpage>1471</fpage>&#x2013;<lpage>1491</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1111/cmi.2009.11.issue-10</pub-id>
</citation>
</ref>
<ref id="B51">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Nakada-Tsukui</surname> <given-names>K.</given-names>
</name>
<name>
<surname>Saito-Nakano</surname> <given-names>Y.</given-names>
</name>
<name>
<surname>Ali</surname> <given-names>V.</given-names>
</name>
<name>
<surname>Nozaki</surname> <given-names>T.</given-names>
</name>
</person-group> (<year>2005</year>). <article-title>A retromerlike complex is a novel Rab7 effector that is involved in the transport of the virulence factor cysteine protease in the enteric protozoan parasite Entamoeba histolytica</article-title>. <source>Mol. Biol. Cell</source> <volume>16</volume>, <fpage>5294</fpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1091/mbc.e05-04-0283</pub-id>
</citation>
</ref>
<ref id="B52">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Novikoff</surname> <given-names>A. B.</given-names>
</name>
<name>
<surname>Novikoff</surname> <given-names>P. M.</given-names>
</name>
<name>
<surname>Davis</surname> <given-names>C.</given-names>
</name>
<name>
<surname>Quintana</surname> <given-names>N.</given-names>
</name>
</person-group> (<year>1972</year>). <article-title>Studies on microperoxisomes. II. A cytochemical method for light and electron microscopy</article-title>. <source>J. Histochem. Cytochem.</source> <volume>20</volume>, <fpage>1006</fpage>&#x2013;<lpage>1023</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1177/20.12.1006</pub-id>
</citation>
</ref>
<ref id="B53">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Oc&#xe1;diz-Ruiz</surname> <given-names>R.</given-names>
</name>
<name>
<surname>Fonseca</surname> <given-names>W.</given-names>
</name>
<name>
<surname>Linford</surname> <given-names>A. S.</given-names>
</name>
<name>
<surname>Yoshino</surname> <given-names>T. P.</given-names>
</name>
<name>
<surname>Orozco</surname> <given-names>E.</given-names>
</name>
<name>
<surname>Rodr&#xed;guez</surname> <given-names>M. A.</given-names>
</name>
</person-group> (<year>2016</year>). <article-title>The knockdown of each component of the cysteine proteinase-adhesin complex of Entamoeba histolytica (EhCPADH) affects the expression of the other complex element as well as the <italic>in vitro</italic> and <italic>in vivo</italic> virulence</article-title>. <source>Parasitology</source> <volume>143</volume>, <fpage>50</fpage>&#x2013;<lpage>59</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1017/S003118201500147X</pub-id>
</citation>
</ref>
<ref id="B54">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Perdomo</surname> <given-names>D.</given-names>
</name>
<name>
<surname>A&#xef;t-Ammar</surname> <given-names>N.</given-names>
</name>
<name>
<surname>Syan</surname> <given-names>S.</given-names>
</name>
<name>
<surname>Sachse</surname> <given-names>M.</given-names>
</name>
<name>
<surname>Jhingan</surname> <given-names>G. D.</given-names>
</name>
<name>
<surname>Guill&#xe9;n</surname> <given-names>N.</given-names>
</name>
</person-group> (<year>2015</year>). <article-title>Cellular and proteomics analysis of the endomembrane system from the unicellular Entamoeba histolytica</article-title>. <source>J. Proteomics</source> <volume>112</volume>, <fpage>125</fpage>&#x2013;<lpage>140</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1016/j.jprot.2014.07.034</pub-id>
</citation>
</ref>
<ref id="B55">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Petri</surname> <given-names>W. A.</given-names>
</name>
<name>
<surname>Haque</surname> <given-names>R.</given-names>
</name>
<name>
<surname>Mann</surname> <given-names>B. J.</given-names>
</name>
</person-group> (<year>2002</year>). <article-title>The bittersweet interface of parasite and host: lectin-carbohydrate interactions during human invasion by the parasite Entamoeba histolytica</article-title>. <source>Annu. Rev. Microbiol.</source> <volume>56</volume>, <fpage>39</fpage>&#x2013;<lpage>64</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1146/annurev.micro.56.012302.160959</pub-id>
</citation>
</ref>
<ref id="B56">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Phillips</surname> <given-names>J. C.</given-names>
</name>
<name>
<surname>Hardy</surname> <given-names>D. J.</given-names>
</name>
<name>
<surname>Maia</surname> <given-names>J. D. C.</given-names>
</name>
<name>
<surname>Stone</surname> <given-names>J. E.</given-names>
</name>
<name>
<surname>Ribeiro</surname> <given-names>J. V.</given-names>
</name>
<name>
<surname>Bernardi</surname> <given-names>R. C.</given-names>
</name>
<etal/>
</person-group>. (<year>2020</year>). <article-title>Scalable molecular dynamics on CPU and GPU architectures with NAMD</article-title>. <source>J. Chem. Phys.</source> <volume>153</volume>, <page-range>1&#x2013;53</page-range>. doi:&#xa0;<pub-id pub-id-type="doi">10.1063/5.0014475/16709547/044130_1_ACCEPTED_MANUSCRIPT.PDF</pub-id>
</citation>
</ref>
<ref id="B57">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Purushothaman</surname> <given-names>L. K.</given-names>
</name>
<name>
<surname>Arlt</surname> <given-names>H.</given-names>
</name>
<name>
<surname>Kuhlee</surname> <given-names>A.</given-names>
</name>
<name>
<surname>Raunser</surname> <given-names>S.</given-names>
</name>
<name>
<surname>Ungermann</surname> <given-names>C.</given-names>
</name>
</person-group> (<year>2017</year>). <article-title>Retromer-driven membrane tubulation separates endosomal recycling from Rab7/Ypt7-dependent fusion</article-title>. <source>Mol. Biol. Cell</source> <volume>28</volume>, <fpage>783</fpage>&#x2013;<lpage>791</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1091/mbc.e16-08-0582</pub-id>
</citation>
</ref>
<ref id="B58">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Ram&#xed;rez-Flores</surname> <given-names>C. J.</given-names>
</name>
<name>
<surname>Cruz-Mir&#xf3;n</surname> <given-names>R.</given-names>
</name>
<name>
<surname>Arroyo</surname> <given-names>R.</given-names>
</name>
<name>
<surname>Mondrag&#xf3;n-Castel&#xe1;n</surname> <given-names>M. E.</given-names>
</name>
<name>
<surname>Nopal-Guerrero</surname> <given-names>T.</given-names>
</name>
<name>
<surname>Gonz&#xe1;lez-Pozos</surname> <given-names>S.</given-names>
</name>
<etal/>
</person-group>. (<year>2019</year>). <article-title>Characterization of metalloproteases and serine proteases of Toxoplasma gondii tachyzoites and their effect on epithelial cells</article-title>. <source>Parasitol. Res.</source> <volume>118</volume>, <fpage>289</fpage>&#x2013;<lpage>306</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1007/s00436-018-6163-5</pub-id>
</citation>
</ref>
<ref id="B59">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Rath</surname> <given-names>P. P.</given-names>
</name>
<name>
<surname>Gourinath</surname> <given-names>S.</given-names>
</name>
</person-group> (<year>2020</year>). <article-title>The actin cytoskeleton orchestra in Entamoeba histolytica</article-title>. <source>Proteins: Struct. Funct. Bioinf.</source> <volume>88</volume>, <fpage>1361</fpage>&#x2013;<lpage>1375</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1002/prot.25955</pub-id>
</citation>
</ref>
<ref id="B60">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Roberts</surname> <given-names>M.</given-names>
</name>
<name>
<surname>Barry</surname> <given-names>S.</given-names>
</name>
<name>
<surname>Woods</surname> <given-names>A.</given-names>
</name>
<name>
<surname>van der Sluijs</surname> <given-names>P.</given-names>
</name>
<name>
<surname>Norman</surname> <given-names>J.</given-names>
</name>
</person-group> (<year>2001</year>). <article-title>PDGF-regulated rab4-dependent recycling of alphavbeta3 integrin from early endosomes is necessary for cell adhesion and spreading</article-title>. <source>Curr. Biol.</source> <volume>11</volume>, <fpage>1392</fpage>&#x2013;<lpage>1402</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1016/S0960-9822(01)00442-0</pub-id>
</citation>
</ref>
<ref id="B61">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Sangar&#xe9;</surname> <given-names>L. O.</given-names>
</name>
<name>
<surname>Alayi</surname> <given-names>T. D.</given-names>
</name>
<name>
<surname>Westermann</surname> <given-names>B.</given-names>
</name>
<name>
<surname>Hovasse</surname> <given-names>A.</given-names>
</name>
<name>
<surname>Sindikubwabo</surname> <given-names>F.</given-names>
</name>
<name>
<surname>Callebaut</surname> <given-names>I.</given-names>
</name>
<etal/>
</person-group>. (<year>2016</year>). <article-title>Unconventional endosome-like compartment and retromer complex in Toxoplasma gondii govern parasite integrity and host infection</article-title>. <source>Nat. Commun.</source> <volume>1</volume>, <fpage>1</fpage>&#x2013;<lpage>14</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1038/ncomms11191</pub-id>
</citation>
</ref>
<ref id="B62">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Seaman</surname> <given-names>M. N. J.</given-names>
</name>
<name>
<surname>Harbour</surname> <given-names>M. E.</given-names>
</name>
<name>
<surname>Tattersall</surname> <given-names>D.</given-names>
</name>
<name>
<surname>Read</surname> <given-names>E.</given-names>
</name>
<name>
<surname>Bright</surname> <given-names>N.</given-names>
</name>
</person-group> (<year>2009</year>). <article-title>Membrane recruitment of the cargo-selective retromer subcomplex is catalysed by the small GTPase Rab7 and inhibited by the Rab-GAP TBC1D5</article-title>. <source>J. Cell Sci.</source> <volume>122</volume>, <fpage>2371</fpage>&#x2013;<lpage>2382</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1242/jcs.048686</pub-id>
</citation>
</ref>
<ref id="B63">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Solis</surname> <given-names>C. F.</given-names>
</name>
<name>
<surname>Santi-Rocca</surname> <given-names>J.</given-names>
</name>
<name>
<surname>Perdomo</surname> <given-names>D.</given-names>
</name>
<name>
<surname>Weber</surname> <given-names>C.</given-names>
</name>
<name>
<surname>Guill&#xe9;n</surname> <given-names>N.</given-names>
</name>
</person-group> (<year>2009</year>). <article-title>Use of bacterially expressed dsRNA to downregulate Entamoeba histolytica gene expression</article-title>. <source>PloS One</source> <volume>4</volume>, <page-range>1&#x2013;11</page-range>. doi:&#xa0;<pub-id pub-id-type="doi">10.1371/journal.pone.0008424</pub-id>
</citation>
</ref>
<ref id="B64">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Srivastava</surname> <given-names>V. K.</given-names>
</name>
<name>
<surname>Yadav</surname> <given-names>R.</given-names>
</name>
<name>
<surname>Watanabe</surname> <given-names>N.</given-names>
</name>
<name>
<surname>Tomar</surname> <given-names>P.</given-names>
</name>
<name>
<surname>Mukherjee</surname> <given-names>M.</given-names>
</name>
<name>
<surname>Gourinath</surname> <given-names>S.</given-names>
</name>
<etal/>
</person-group>. (<year>2017</year>). <article-title>Structural and thermodynamic characterization of metal binding in Vps29 from Entamoeba histolytica: implication in retromer function</article-title>. <source>Mol. Microbiol.</source> <volume>106</volume>, <fpage>562</fpage>&#x2013;<lpage>581</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1111/mmi.13836</pub-id>
</citation>
</ref>
<ref id="B65">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Takiff</surname> <given-names>H. E.</given-names>
</name>
<name>
<surname>Chen</surname> <given-names>S.-M.</given-names>
</name>
<name>
<surname>Courtt</surname> <given-names>D. L.</given-names>
</name>
<name>
<surname>Morri-Son</surname> <given-names>P. T.</given-names>
</name>
<name>
<surname>Lovett</surname> <given-names>S. T.</given-names>
</name>
<name>
<surname>Gilson</surname> <given-names>L.</given-names>
</name>
<etal/>
</person-group>. (<year>1989</year>). <article-title>Genetic analysis of the rnc operon of Escherichia coli</article-title>. <source>J. Bacteriol.</source> <volume>171</volume>, <fpage>2581</fpage>&#x2013;<lpage>2590</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1128/jb.171.5.2581-2590.1989</pub-id>
</citation>
</ref>
<ref id="B66">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Talam&#xe1;s-Lara</surname> <given-names>D.</given-names>
</name>
<name>
<surname>Acosta-Virgen</surname> <given-names>K.</given-names>
</name>
<name>
<surname>Ch&#xe1;vez-Mungu&#xed;a</surname> <given-names>B.</given-names>
</name>
<name>
<surname>Lagunes-Guill&#xe9;n</surname> <given-names>A.</given-names>
</name>
<name>
<surname>Salazar-Villatoro</surname> <given-names>L.</given-names>
</name>
<name>
<surname>Espinosa-Cantellano</surname> <given-names>M.</given-names>
</name>
<etal/>
</person-group>. (<year>2021</year>). <article-title>Golgi apparatus components in Entamoeba histolytica and Entamoeba dispar after monensin treatment</article-title>. <source>Microsc. Res. Tech.</source> <volume>84</volume>, <fpage>1887</fpage>&#x2013;<lpage>1896</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1002/jemt.23745</pub-id>
</citation>
</ref>
<ref id="B67">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Tomavo</surname> <given-names>S.</given-names>
</name>
<name>
<surname>Slomianny</surname> <given-names>C.</given-names>
</name>
<name>
<surname>Meissner</surname> <given-names>M.</given-names>
</name>
<name>
<surname>Carruthers</surname> <given-names>V. B.</given-names>
</name>
</person-group> (<year>2013</year>). <article-title>Protein trafficking through the endosomal system prepares intracellular parasites for a home invasion</article-title>. <source>PloS Pathog.</source> <volume>9</volume>, <elocation-id>e1003629</elocation-id>. doi:&#xa0;<pub-id pub-id-type="doi">10.1371/journal.ppat.1003629</pub-id>
</citation>
</ref>
<ref id="B68">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>van Weering</surname> <given-names>J. R. T.</given-names>
</name>
<name>
<surname>Verkade</surname> <given-names>P.</given-names>
</name>
<name>
<surname>Cullen</surname> <given-names>P. J.</given-names>
</name>
</person-group> (<year>2010</year>). <article-title>SNX&#x2013;BAR proteins in phosphoinositide-mediated, tubular-based endosomal sorting</article-title>. <source>Semin. Cell Dev. Biol.</source> <volume>21</volume>, <fpage>371</fpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1016/j.semcdb.2009.11.009</pub-id>
</citation>
</ref>
<ref id="B69">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Wang</surname> <given-names>S.</given-names>
</name>
<name>
<surname>Bellen</surname> <given-names>H. J.</given-names>
</name>
</person-group> (<year>2015</year>). <article-title>The retromer complex in development and disease</article-title>. <source>Development</source> <volume>142</volume>, <fpage>2392</fpage>&#x2013;<lpage>2396</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1242/dev.123737</pub-id>
</citation>
</ref>
<ref id="B70">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Watanabe</surname> <given-names>N.</given-names>
</name>
<name>
<surname>Nakada-Tsukui</surname> <given-names>K.</given-names>
</name>
<name>
<surname>Nozaki</surname> <given-names>T.</given-names>
</name>
</person-group> (<year>2020</year>). <article-title>Two isotypes of phosphatidylinositol 3-phosphate-binding sorting nexins play distinct roles in trogocytosis in Entamoeba histolytica</article-title>. <source>Cell Microbiol.</source> <volume>22</volume>, <page-range>1&#x2013;16</page-range>. doi:&#xa0;<pub-id pub-id-type="doi">10.1111/cmi.13144</pub-id>
</citation>
</ref>
<ref id="B71">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Ye</surname> <given-names>H.</given-names>
</name>
<name>
<surname>Ojelade</surname> <given-names>S. A.</given-names>
</name>
<name>
<surname>Li-Kroeger</surname> <given-names>D.</given-names>
</name>
<name>
<surname>Zuo</surname> <given-names>Z.</given-names>
</name>
<name>
<surname>Wang</surname> <given-names>L.</given-names>
</name>
<name>
<surname>Li</surname> <given-names>Y.</given-names>
</name>
<etal/>
</person-group>. (<year>2020</year>). <article-title>Retromer subunit, vps29, regulates synaptic transmission and is required for endolysosomal function in the aging brain</article-title>. <source>Elife</source> <volume>9</volume>, <page-range>1&#x2013;33</page-range>. doi:&#xa0;<pub-id pub-id-type="doi">10.7554/eLife.51977.sa2</pub-id>
</citation>
</ref>
<ref id="B72">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Zavodszky</surname> <given-names>E.</given-names>
</name>
<name>
<surname>Seaman</surname> <given-names>M. N. J.</given-names>
</name>
<name>
<surname>Moreau</surname> <given-names>K.</given-names>
</name>
<name>
<surname>Jimenez-Sanchez</surname> <given-names>M.</given-names>
</name>
<name>
<surname>Breusegem</surname> <given-names>S. Y.</given-names>
</name>
<name>
<surname>Harbour</surname> <given-names>M. E.</given-names>
</name>
<etal/>
</person-group>. (<year>2014</year>). <article-title>Mutation in VPS35 associated with Parkinson&#x2019;s disease impairs WASH complex association and inhibits autophagy</article-title>. <source>Nat. Commun.</source> <volume>1</volume>, <fpage>1</fpage>&#x2013;<lpage>16</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1038/ncomms4828</pub-id>
</citation>
</ref>
<ref id="B73">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Zelazny</surname> <given-names>E.</given-names>
</name>
<name>
<surname>Santambrogio</surname> <given-names>M.</given-names>
</name>
<name>
<surname>Gaude</surname> <given-names>T.</given-names>
</name>
</person-group> (<year>2013</year>). <article-title>Retromer association with membranes: Plants have their own rules</article-title>! <source>Plant Signal Behav.</source> <volume>8</volume>, <page-range>1&#x2013;4</page-range>. doi:&#xa0;<pub-id pub-id-type="doi">10.4161/PSB.25312</pub-id>
</citation>
</ref>
<ref id="B74">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Zhang</surname> <given-names>H.</given-names>
</name>
<name>
<surname>Huang</surname> <given-names>T.</given-names>
</name>
<name>
<surname>Hong</surname> <given-names>Y.</given-names>
</name>
<name>
<surname>Yang</surname> <given-names>W.</given-names>
</name>
<name>
<surname>Zhang</surname> <given-names>X.</given-names>
</name>
<name>
<surname>Luo</surname> <given-names>H.</given-names>
</name>
<etal/>
</person-group>. (<year>2018</year>). <article-title>The retromer complex and sorting nexins in neurodegenerative diseases</article-title>. <source>Front. Aging Neurosci.</source> <volume>10</volume>. doi:&#xa0;<pub-id pub-id-type="doi">10.3389/fnagi.2018.00079</pub-id>
</citation>
</ref>
<ref id="B75">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Zhao</surname> <given-names>X.</given-names>
</name>
<name>
<surname>Nothwehr</surname> <given-names>S.</given-names>
</name>
<name>
<surname>Lara-Lemus</surname> <given-names>R.</given-names>
</name>
<name>
<surname>Zhang</surname> <given-names>B. Y.</given-names>
</name>
<name>
<surname>Peter</surname> <given-names>H.</given-names>
</name>
<name>
<surname>Arvan</surname> <given-names>P.</given-names>
</name>
</person-group> (<year>2007</year>). <article-title>Dominant-negative behavior of mammalian Vps35 in yeast requires a conserved PRLYL motif involved in retromer assembly</article-title>. <source>Traffic</source> <volume>8</volume>, <fpage>1829</fpage>&#x2013;<lpage>1840</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1111/j.1600-0854.2007.00658.x</pub-id>
</citation>
</ref>
<ref id="B76">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Zhou</surname> <given-names>M.</given-names>
</name>
<name>
<surname>Wiener</surname> <given-names>H.</given-names>
</name>
<name>
<surname>Su</surname> <given-names>W.</given-names>
</name>
<name>
<surname>Zhou</surname> <given-names>Y.</given-names>
</name>
<name>
<surname>Liot</surname> <given-names>C.</given-names>
</name>
<name>
<surname>Ahearn</surname> <given-names>I.</given-names>
</name>
<etal/>
</person-group>. (<year>2016</year>). <article-title>VPS35 binds farnesylated N-Ras in the cytosol to regulate N-Ras trafficking</article-title>. <source>J. Cell Biol.</source> <volume>214</volume>, <fpage>445</fpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1083/jcb.201604061</pub-id>
</citation>
</ref>
</ref-list>
</back>
</article>