<?xml version="1.0" encoding="UTF-8"?>
<!DOCTYPE article PUBLIC "-//NLM//DTD Journal Publishing DTD v2.3 20070202//EN" "journalpublishing.dtd">
<article article-type="review-article" dtd-version="2.3" xml:lang="EN" xmlns:mml="http://www.w3.org/1998/Math/MathML" xmlns:xlink="http://www.w3.org/1999/xlink">
<front>
<journal-meta>
<journal-id journal-id-type="publisher-id">Front. Mol. Biosci.</journal-id>
<journal-title>Frontiers in Molecular Biosciences</journal-title>
<abbrev-journal-title abbrev-type="pubmed">Front. Mol. Biosci.</abbrev-journal-title>
<issn pub-type="epub">2296-889X</issn>
<publisher>
<publisher-name>Frontiers Media S.A.</publisher-name>
</publisher>
</journal-meta>
<article-meta>
<article-id pub-id-type="publisher-id">887763</article-id>
<article-id pub-id-type="doi">10.3389/fmolb.2022.887763</article-id>
<article-categories>
<subj-group subj-group-type="heading">
<subject>Molecular Biosciences</subject>
<subj-group>
<subject>Review</subject>
</subj-group>
</subj-group>
</article-categories>
<title-group>
<article-title>Antimicrobial Peptide Analogs From Scorpions: Modifications and Structure-Activity</article-title>
<alt-title alt-title-type="left-running-head">Amorim-Carmo et al.</alt-title>
<alt-title alt-title-type="right-running-head">Antimicrobial Peptide Analogs From Scorpions</alt-title>
</title-group>
<contrib-group>
<contrib contrib-type="author">
<name>
<surname>Amorim-Carmo</surname>
<given-names>Bruno</given-names>
</name>
<xref ref-type="aff" rid="aff1">
<sup>1</sup>
</xref>
<xref ref-type="fn" rid="fn1">
<sup>&#x2020;</sup>
</xref>
<uri xlink:href="https://loop.frontiersin.org/people/647639/overview"/>
</contrib>
<contrib contrib-type="author">
<name>
<surname>Parente</surname>
<given-names>Adriana M. S.</given-names>
</name>
<xref ref-type="aff" rid="aff1">
<sup>1</sup>
</xref>
<xref ref-type="fn" rid="fn1">
<sup>&#x2020;</sup>
</xref>
<uri xlink:href="https://loop.frontiersin.org/people/1720236/overview"/>
</contrib>
<contrib contrib-type="author">
<name>
<surname>Souza</surname>
<given-names>Eden S.</given-names>
</name>
<xref ref-type="aff" rid="aff2">
<sup>2</sup>
</xref>
<uri xlink:href="https://loop.frontiersin.org/people/819570/overview"/>
</contrib>
<contrib contrib-type="author">
<name>
<surname>Silva-Junior</surname>
<given-names>Arn&#xf3;bio A.</given-names>
</name>
<xref ref-type="aff" rid="aff1">
<sup>1</sup>
</xref>
<uri xlink:href="https://loop.frontiersin.org/people/1615697/overview"/>
</contrib>
<contrib contrib-type="author">
<name>
<surname>Ara&#xfa;jo</surname>
<given-names>Renata M.</given-names>
</name>
<xref ref-type="aff" rid="aff1">
<sup>1</sup>
</xref>
<uri xlink:href="https://loop.frontiersin.org/people/1815125/overview"/>
</contrib>
<contrib contrib-type="author" corresp="yes">
<name>
<surname>Fernandes-Pedrosa</surname>
<given-names>Matheus F.</given-names>
</name>
<xref ref-type="aff" rid="aff1">
<sup>1</sup>
</xref>
<xref ref-type="corresp" rid="c001">&#x2a;</xref>
<uri xlink:href="https://loop.frontiersin.org/people/652660/overview"/>
</contrib>
</contrib-group>
<aff id="aff1">
<sup>1</sup>
<institution>Laboratory of Pharmaceutical Technology and Biotechnology</institution>, <institution>Pharmacy Department</institution>, <institution>Federal University of Rio Grande do North</institution>, <addr-line>Natal</addr-line>, <country>Brazil</country>
</aff>
<aff id="aff2">
<sup>2</sup>
<institution>School of Biomolecular and Biomedical Sciences</institution>, <institution>University College Dublin</institution>, <addr-line>Dublin</addr-line>, <country>Ireland</country>
</aff>
<author-notes>
<fn fn-type="edited-by">
<p>
<bold>Edited by:</bold> <ext-link ext-link-type="uri" xlink:href="https://loop.frontiersin.org/people/796420/overview">Hang Fai Kwok</ext-link>, University of Macau, China</p>
</fn>
<fn fn-type="edited-by">
<p>
<bold>Reviewed by:</bold> <ext-link ext-link-type="uri" xlink:href="https://loop.frontiersin.org/people/995982/overview">Ammar Almaaytah</ext-link>, Jordan University of Science and Technology, Jordan</p>
<p>
<ext-link ext-link-type="uri" xlink:href="https://loop.frontiersin.org/people/1574409/overview">Gerardo Corzo</ext-link>, Universidad Nacional Aut&#xf3;noma de M&#xe9;xico, Mexico</p>
<p>
<ext-link ext-link-type="uri" xlink:href="https://loop.frontiersin.org/people/558599/overview">Gandhi Radis Baptista</ext-link>, Federal University of Ceara, Brazil</p>
</fn>
<corresp id="c001">&#x2a;Correspondence: Matheus F. Fernandes-Pedrosa, <email>matheus.pedrosa@ufrn.br</email>
</corresp>
<fn fn-type="equal" id="fn1">
<label>
<sup>&#x2020;</sup>
</label>
<p>These authors have contributed equally to this work and share first authorship</p>
</fn>
<fn fn-type="other">
<p>This article was submitted to Protein Biochemistry for Basic and Applied Sciences, a section of the journal Frontiers in Molecular Biosciences</p>
</fn>
</author-notes>
<pub-date pub-type="epub">
<day>26</day>
<month>05</month>
<year>2022</year>
</pub-date>
<pub-date pub-type="collection">
<year>2022</year>
</pub-date>
<volume>9</volume>
<elocation-id>887763</elocation-id>
<history>
<date date-type="received">
<day>02</day>
<month>03</month>
<year>2022</year>
</date>
<date date-type="accepted">
<day>19</day>
<month>04</month>
<year>2022</year>
</date>
</history>
<permissions>
<copyright-statement>Copyright &#xa9; 2022 Amorim-Carmo, Parente, Souza, Silva-Junior, Ara&#xfa;jo and Fernandes-Pedrosa.</copyright-statement>
<copyright-year>2022</copyright-year>
<copyright-holder>Amorim-Carmo, Parente, Souza, Silva-Junior, Ara&#xfa;jo and Fernandes-Pedrosa</copyright-holder>
<license xlink:href="http://creativecommons.org/licenses/by/4.0/">
<p>This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.</p>
</license>
</permissions>
<abstract>
<p>The rapid development of multidrug-resistant pathogens against conventional antibiotics is a global public health problem. The irrational use of antibiotics has promoted therapeutic limitations against different infections, making research of new molecules that can be applied to treat infections necessary. Antimicrobial peptides (AMPs) are a class of promising antibiotic molecules as they present broad action spectrum, potent activity, and do not easily induce resistance. Several AMPs from scorpion venoms have been described as a potential source for the development of new drugs; however, some limitations to their application are also observed. Here, we describe strategies used in several approaches to optimize scorpion AMPs, addressing their primary sequence, biotechnological potential, and characteristics that should be considered when developing an AMP derived from scorpion venoms. In addition, this review may contribute towards improving the understanding of rationally designing new molecules, targeting functional AMPs that may have a therapeutic application.</p>
</abstract>
<kwd-group>
<kwd>antimicrobial activity</kwd>
<kwd>structural modification</kwd>
<kwd>scorpion peptides</kwd>
<kwd>hemolytic activity</kwd>
<kwd>analog peptides</kwd>
</kwd-group>
</article-meta>
</front>
<body>
<sec id="s1">
<title>Introduction</title>
<p>Antimicrobial peptides (AMPs) are constitutively expressed small bioactive molecules (<xref ref-type="bibr" rid="B104">Peters et al., 2010</xref>; <xref ref-type="bibr" rid="B117">Soliman et al., 2013</xref>). However, studies indicate that proteolytic cleavage of functional proteins can result in AMPs (<xref ref-type="bibr" rid="B85">Lyapina et al., 2019</xref>). AMPs have been identified in a variety of life forms, such as unicellular microorganisms, invertebrates, plants, amphibians, birds, fish, and mammals, including humans, where they act as part of the innate immune system against pathogenic microorganisms (<xref ref-type="bibr" rid="B59">Gopal et al., 2013</xref>; <xref ref-type="bibr" rid="B2">Almaaytah and Albalas, 2014</xref>). Altogether, diversity of AMPs and their presence in a variety of organisms indicate their relevance for immune defense (<xref ref-type="bibr" rid="B19">Brogden and Brogden, 2011</xref>; <xref ref-type="bibr" rid="B52">Fjell et al., 2012</xref>).</p>
<p>AMPs can also show activity against tumor cells (<xref ref-type="bibr" rid="B32">Crack et al., 2012</xref>), virus (<xref ref-type="bibr" rid="B84">Luplertlop et al., 2011</xref>), and protozoa (<xref ref-type="bibr" rid="B122">Torrent et al., 2012</xref>), and for this reason, they are often classified as multifunctional peptides (<xref ref-type="bibr" rid="B145">Zeng et al., 2013</xref>). These activities are not necessarily excluding, and AMPs might also act synergistically in more than one activity (<xref ref-type="bibr" rid="B30">Conlon et al., 2010</xref>; <xref ref-type="bibr" rid="B58">Gong et al., 2010</xref>; <xref ref-type="bibr" rid="B145">Zeng et al., 2013</xref>).</p>
<p>Although invertebrates lack adaptative immunity, they can rely on an effective innate response, which is not as basic as once thought (<xref ref-type="bibr" rid="B47">Divangahi et al., 2021</xref>). AMPs are key molecules in the defense mechanism of invertebrates (<xref ref-type="bibr" rid="B137">Wu et al., 2021</xref>). Within arthropods, insects are the most studied class, and the AMP diversity in this class includes the AMP families cecropins, defensins (<xref ref-type="bibr" rid="B15">Brady et al., 2019</xref>), and gloverins (<xref ref-type="bibr" rid="B132">Wang et al., 2019</xref>), among others (<xref ref-type="bibr" rid="B136">Wu et al., 2018</xref>; <xref ref-type="bibr" rid="B21">Buonocore et al., 2021</xref>).</p>
<p>Arthropods also include scorpions, from which several bioactive molecules have been isolated from the venom glands. AMPs are one of these molecules and aid in the protection of the gland against infections caused by saprophytic organisms and facilitate the activity of neurotoxins (<xref ref-type="bibr" rid="B67">Hern&#xe1;ndez-Aponte et al., 2011</xref>; <xref ref-type="bibr" rid="B1">Ahmadi et al., 2020</xref>; <xref ref-type="bibr" rid="B114">Shahzadi et al., 2021</xref>). The diversity of AMPs isolated from scorpions comprises families present in a variety of life forms, such as defensins (<xref ref-type="bibr" rid="B25">Cheng et al., 2020</xref>), and AMPs that were first known to be present in scorpion species, such as scorpine from <italic>Pandinus imperator</italic> (<xref ref-type="bibr" rid="B29">Conde et al., 2000</xref>) and Heterin-2 from <italic>Heterometrus spinifer</italic> (<xref ref-type="bibr" rid="B138">Wu S. et al., 2014</xref>). Scorpion AMPs were classified elsewhere as proline- and glycine-rich AMPs, AMPs with cysteine that create disulfide bridges, and &#x3b1;-helical AMPs without cysteine (<xref ref-type="bibr" rid="B66">Harrison et al., 2014</xref>). Although &#x3b1;-helical AMPs are more common, scorpion venom may also contain AMPs with disulfide bridges, as in the case of HS-1 that has three of these interactions (<xref ref-type="bibr" rid="B127">Uawonggul et al., 2007</xref>). Cationic AMPs without disulfide bridges in scorpions have already been demonstrated to have multifunctional activity, for example, antifungal, antiviral, antiparasitic, and antiproliferative (<xref ref-type="bibr" rid="B90">Miyashita et al., 2010</xref>; <xref ref-type="bibr" rid="B4">Almaaytah et al., 2014</xref>; <xref ref-type="bibr" rid="B48">Du et al., 2014</xref>; <xref ref-type="bibr" rid="B51">Erde&#x15f; et al., 2014</xref>). The main mechanism of action reported is the formation of pores in the cell membrane of the pathogen, which reduces the ability of these microorganisms to develop resistance (<xref ref-type="bibr" rid="B2">Almaaytah and Albalas, 2014</xref>; <xref ref-type="bibr" rid="B100">Parachin and Franco, 2014</xref>; <xref ref-type="bibr" rid="B99">Ortiz et al., 2015</xref>).</p>
<p>The first AMP reported from scorpion venom, named Hadrurin, was isolated from the species <italic>Hadrurus aztecus</italic> in 2000 (<xref ref-type="bibr" rid="B123">Torres-Larios et al., 2000</xref>; <xref ref-type="bibr" rid="B5">Almaaytah et al., 2012</xref>); ever since, several AMPs from different scorpion species have been isolated and characterized (<xref ref-type="bibr" rid="B66">Harrison et al., 2014</xref>). Scorpion venom AMPs usually present a random structure in aqueous media and a predominant helix structure in hydrophobic media. This ability to acquire different conformations in different media may be related to their activity in cell membranes (<xref ref-type="bibr" rid="B80">Li et al., 2014</xref>; <xref ref-type="bibr" rid="B34">Daniele-Silva et al., 2016</xref>; <xref ref-type="bibr" rid="B82">Luna-Ramirez et al., 2017</xref>). Moreover, AMPs from distinct scorpion species have been observed to present hemolytic and cytotoxic effects against eukaryotic cell lines, and high susceptibility to the activity of proteolytic enzymes, which is a hindrance to their therapeutic application (<xref ref-type="bibr" rid="B143">Yeaman and Yount, 2003</xref>; <xref ref-type="bibr" rid="B144">Zeng et al., 2012</xref>; <xref ref-type="bibr" rid="B2">Almaaytah and Albalas, 2014</xref>).</p>
<p>Nevertheless, there is still great interest in the development of AMPs as a potential class of antimicrobial agents, due to their high activity <italic>in vitro</italic> with a broad action spectrum (<xref ref-type="bibr" rid="B5">Almaaytah et al., 2012</xref>). Thereby, various structural determinants are responsible for the antimicrobial and cytolytic activities of these peptides. Studies demonstrate that the increment in the &#x3b1;-helix conformation, cationic character, hydrophobicity, and the hydrophobic moment of a native AMP can enhance its antibiotic action spectrum (<xref ref-type="bibr" rid="B130">Wang et al., 2008</xref>; <xref ref-type="bibr" rid="B147">Zhao et al., 2009</xref>; <xref ref-type="bibr" rid="B96">Nguyen et al., 2011</xref>). C-terminal amidation is another important AMP modification as it can increase resistance to proteolysis and stability of the amphipathic helices (<xref ref-type="bibr" rid="B113">Sfor&#xe7;a et al., 2004</xref>). The substitutions of amino acids in the short peptide chain have shown alterations in the structural conformation and, therefore, can improve the characteristics of native peptides, increasing their biological activity and stability and reducing their toxicity. Therefore, modification of the chemical composition of AMPs is a powerful and promising tool to increase their biotechnological potential and to develop more bioactive and less toxic antimicrobial molecules (<xref ref-type="bibr" rid="B96">Nguyen et al., 2011</xref>; <xref ref-type="bibr" rid="B52">Fjell et al., 2012</xref>; <xref ref-type="bibr" rid="B101">Parente et al., 2018</xref>).</p>
<p>A clearer understanding of the influence of these characteristics on peptide structures can help develop new strategies that will facilitate the design of pharmacological agents that will improve or optimize their therapeutic potential, as well as reduce the rate of microbial resistance acquired from AMPs. Thus, this review aims to address the AMPs found in scorpion venom and the most common modifications used to increase their antimicrobial activity and modulate their toxicity to human cells, in addition to the possible application of scorpion AMPs as an anti-infective therapeutic agent.</p>
</sec>
<sec id="s2">
<title>Physicochemical Properties That Influence the Antimicrobial Activities of Antimicrobial Peptides</title>
<sec id="s2-1">
<title>Peptide Sequence and Conformation</title>
<p>Scorpion AMPs are small amino acid chains, usually ranging from about 10 to 25 amino acids, and it has been suggested that sequence length may be of significance to their activity. The short size makes AMPs more attractive from the chemical synthesis point of view, as it is less costly to synthesize small molecules (<xref ref-type="bibr" rid="B79">Li and Brimble, 2019</xref>). Therefore, small peptides are more advantageous for large-scale chemical synthesis.</p>
<p>The sequence size is also important to their defense function, since, when compared with bigger robust proteins, they can insert in the cytoplasmic membrane efficiently. Furthermore, a study using artificial intelligence 100,000 peptides of which 200 were synthetized and tested; the results showed that a peptide shorter than usual, containing nine amino-acid residues, presented minimum inhibitory concentration (MIC) lower than 1 &#xb5;M (<xref ref-type="bibr" rid="B26">Cherkasov et al., 2009</xref>). Other studies using antimicrobial peptides derived from other animals also showed that shortened peptides produced better antimicrobial activity (<xref ref-type="bibr" rid="B118">Solstad et al., 2020</xref>; <xref ref-type="bibr" rid="B53">Fuscaldi et al., 2021</xref>).</p>
<p>Although scorpion AMPs have a highly diverse amino acid sequence, hydrophobic and basic residues are found in most peptides. The presence of such residues results in similar physicochemical properties among AMPs. In addition to the observed heterogeneity, these peptides present similar physicochemical properties, such as amphipathicity and positive net charge, which are important to their interactions with microbial membranes (<xref ref-type="bibr" rid="B96">Nguyen et al., 2011</xref>; <xref ref-type="bibr" rid="B78">Leite et al., 2015</xref>). One common posttranslational modification used in AMPs is C-terminal amidation, which is highly important not only to protect these peptides from proteolysis but also because it plays a role in their antimicrobial activity by stabilizing the peptide&#x2013;membrane interaction (<xref ref-type="bibr" rid="B43">Dennison et al., 2015</xref>; <xref ref-type="bibr" rid="B93">Mura et al., 2016</xref>).</p>
<p>Conserved amino acid residues found in different peptides play a similar role. In <xref ref-type="fig" rid="F1">Figure 1</xref> we present a sequence alignment between AMPs from different scorpion species, in which conserved residues can be observed throughout the sequence. At the center of these sequences, there is a G-L-I/V-S-A domain. These conserved amino acids may be important for their activity, or even for the maintenance of the peptide structure.</p>
<fig id="F1" position="float">
<label>FIGURE 1</label>
<caption>
<p>Sequence alignment of 10 scorpion antimicrobial peptides. &#x2a;Conserved residues.</p>
</caption>
<graphic xlink:href="fmolb-09-887763-g001.tif"/>
</fig>
<p>Scorpion AMPs present a more flexible structure as most of them lack cysteine and disulfide bonds. This feature allows such AMPs to alter their conformation according to the environment. In hydrophilic solvents, scorpion AMPs present random conformation, but when in hydrophobic solvents, they show an &#x3b1;-helical conformation. This behavior has been confirmed through <italic>in vitro</italic> and <italic>in silico</italic> experiments (<xref ref-type="bibr" rid="B40">Melo et al., 2015</xref>; <xref ref-type="bibr" rid="B101">Parente et al., 2018</xref>). This conformation change grants that when AMPs are in an aqueous intercellular environment, they present random conformation, thus being inactive, but when in contact with the membrane hydrophobic environment, they assume an &#x3b1;-helical conformation and so insert in the membrane (<xref ref-type="bibr" rid="B96">Nguyen et al., 2011</xref>; <xref ref-type="bibr" rid="B2">Almaaytah and Albalas, 2014</xref>). Thus, both peptide sequence and conformation are important for AMPs&#x2019; insertion in the membrane and activity. However, due to limited studies, information on the specific impact of each amino acid on the peptide action mechanism is still scarce.</p>
</sec>
<sec id="s2-2">
<title>C-Terminal Amidation</title>
<p>Peptides can be rapidly hydrolyzed when in contact with proteases presented in our organism or proteases produced by bacteria (<xref ref-type="bibr" rid="B91">Moncla et al., 2011</xref>). Hence, they can show lower oral and plasmatic activity (<xref ref-type="bibr" rid="B28">Christophersen et al., 2014</xref>). This has boosted studies that aim, through the rational amino-acid deletion, addition, or replacement, the development of biologically active analogs with physicochemical properties capable of enhancing their potentiality and improving their stability against proteases (<xref ref-type="bibr" rid="B74">Kumar and Bhalla, 2005</xref>; <xref ref-type="bibr" rid="B95">Ne&#x161;uta et al., 2017</xref>).</p>
<p>In the vast group of AMPs extracted from various organisms, the importance of C-terminal amidation is highlighted, and most bioactive native peptides are known to present it, establishing that this can be an important characteristic for their activity. Furthermore, several studies have evaluated the effect of C-terminal amidation on AMPs&#x2019; stability, efficiency, and toxicity (<xref ref-type="bibr" rid="B113">Sfor&#xe7;a et al., 2004</xref>). It was shown that amidated peptides were more resistant to protease activity and that amidation stabilizes &#x3b1;-helix formation (<xref ref-type="bibr" rid="B17">Brinckerhoff et al., 1999</xref>; <xref ref-type="bibr" rid="B45">Dennison and Phoenix, 2011</xref>).</p>
<p>However, one study analyzed several amidated and non-amidated antimicrobial peptides and observed that amidation of the C-terminal region does indeed have a variable effect on the peptide structure, as some of these peptides lost their activity, while others maintained their antimicrobial activity in the absence of amidation (<xref ref-type="bibr" rid="B119">Strandberg et al., 2007</xref>). The same study showed that a peptide&#x2019;s toxicity to prokaryotic and eukaryotic cells might not be affected by the presence or absence of the C-terminal amidation, indicating that it has a variable effect on the peptide sequence (<xref ref-type="bibr" rid="B119">Strandberg et al., 2007</xref>). <xref ref-type="bibr" rid="B44">Dennison et al. (2009)</xref> concluded in their study that C-terminal amidation of defense peptides has a variable effect on their antimicrobial activity and no clear effect on their selectivity for these cell types. Therefore, C-terminal amidation needs to be considered based mainly on the structure of the native peptide (presence or absence of C-terminal amidation) used as a prototype when designing a new antimicrobial agent.</p>
</sec>
<sec id="s2-3">
<title>Amphipathicity</title>
<p>The amphipathic (A) aspect of AMPs with &#x3b1;-helical conformation is directly dependent on the amino acid sequence (<xref ref-type="bibr" rid="B46">Dennison et al., 2005</xref>; <xref ref-type="bibr" rid="B134">Wiradharma et al., 2011</xref>; <xref ref-type="bibr" rid="B146">Zhang et al., 2016</xref>; <xref ref-type="bibr" rid="B20">Brul, 2018</xref>; <xref ref-type="bibr" rid="B106">Riahifard et al., 2018</xref>). Hydrophobic amino acids are periodically distributed in amphipathic helices, and a simple replacement of arginine by lysine can boost activity without increasing the toxicity to the host (<xref ref-type="bibr" rid="B57">Gim&#xe9;nez-Andr&#xe9;s et al., 2018</xref>; <xref ref-type="bibr" rid="B83">Luo et al., 2021</xref>).</p>
<p>Initially, hydrophobic residues insert in the membrane and interact through hydrophobic forces, causing membrane permeabilization (<xref ref-type="bibr" rid="B115">Shai, 1999</xref>; <xref ref-type="bibr" rid="B70">Karmakar et al., 2019</xref>). Insertion of the peptide into the membrane process starts with the attachment of the amphipathic cationic helix to the membrane in a flat orientation. The membrane&#x2013;AMP interaction occurs with the AMP hydrophobic face interacting with the membrane and the polar face of the peptide interacting with the solvent. Then, the complex membrane&#x2013;AMP reaches an equilibrium state prior to the pore-forming activity (<xref ref-type="bibr" rid="B54">Gagnon et al., 2017</xref>).</p>
<p>To better illustrate the amphipathicity of &#x3b1;-helical AMPs, two AMP structures from scorpion species were chosen: IsCT, a peptide present in <italic>Opisthacanthus madagascariensis</italic>, and Stigmurin, isolated from <italic>Tityus stigmurus</italic> (<xref ref-type="fig" rid="F2">Figure 2</xref>). It is possible to observe the amphipathic character of these structures through the hydrophobic and hydrophilic regions well distributed along the peptide chain. It is noticeable that Stigmurin exhibits greater hydrophobicity than IsCT (<xref ref-type="bibr" rid="B33">Dai et al., 2001</xref>; <xref ref-type="bibr" rid="B35">Daniele-Silva et al., 2021</xref>).</p>
<fig id="F2" position="float">
<label>FIGURE 2</label>
<caption>
<p>Theoretical tridimensional structure using UCSF Chimera software (<xref ref-type="bibr" rid="B105">Pettersen et al., 2004</xref>) for the peptides IsCT <bold>(A)</bold> and Stigmurin <bold>(C)</bold>. In <bold>(B,D)</bold> peptides IsCT and Stigmurin in electrostatic surface, respectively. Light blue and dark blue represent hydrophilic and hydrophobic regions, respectively.</p>
</caption>
<graphic xlink:href="fmolb-09-887763-g002.tif"/>
</fig>
<p>Although amphipathicity is very important to the antimicrobial activity, its increment does not seem to increase the antibacterial activity (<xref ref-type="bibr" rid="B141">Yan et al., 2003</xref>). <xref ref-type="bibr" rid="B124">Tossi et al. (2000)</xref> also observed that the antimicrobial activity of AMPs is little affected by a change in amphipathicity. On the other hand, the superficial amphipathicity of peptides is associated with cell type selectivity, as it was observed by Wiradharma and collaborators (2011). The authors found that the synthetic peptides (FFRR)<sub>3</sub>, (LLRR)<sub>3</sub>, and (LLKK)<sub>3</sub> showed stronger antimicrobial activity and lower toxicity against red blood cells when compared with another peptide tested (AARR)<sub>3</sub>. The authors attribute the lack of activity of (AARR)<sub>3</sub> to poorer amphipathicity in this peptide, which was caused by high hydrophilicity of alanine residues. Other peptides designed with two and four repeats (i.e., (FFRR)<sub>2</sub>), showed lower antimicrobial activity and higher toxicity. This indicates that the size and amino acid composition of the amphipathic helix may be modulated to obtain greater efficacy. Although amphipathic cationic helices are widely common among AMPs, there are many reports of AMPs structured as &#x03B2;-sheets, especially designed peptides. As an example, the synthetic peptide (KIGAKI)<sub>3</sub>-NH<sub>2</sub>, which was designed to have amphipathic features and fold as a &#x3b2;-sheet, exhibited higher antimicrobial activity and lower hemolytic activity than the &#x3b1;-helical peptides tested by the authors (<xref ref-type="bibr" rid="B14">Blazyk et al., 2001</xref>). &#x3b2;-Sheets are reported in AMPs from the scorpion <italic>Mesobuthus martensii</italic>, for example, CS&#x3b1;&#x3b2; defensin and HAP-1 from <italic>Mesobuthus martensii</italic> (<xref ref-type="bibr" rid="B75">Lang et al., 2017</xref>; <xref ref-type="bibr" rid="B116">Shi et al., 2018</xref>). However, synthesis of &#x3b1;-helical peptides is still preferred due to its lower cost. &#x3b2;-Sheet conformations exhibit disulfide bridges to stabilize their structure, thus increasing the synthesis cost (<xref ref-type="bibr" rid="B60">Gro&#xdf; et al., 2016</xref>).</p>
</sec>
<sec id="s2-4">
<title>Hydrophobicity</title>
<p>As aforementioned, AMPs have both acidic and basic amino acids; therefore, they present an amphipathic character that gives them the ability to solubilize in both hydrophobic and hydrophilic solvents. These peptides present particularly high hydrophobicity (H), which is important for their insertion into the cytoplasmic membrane through hydrophobic interactions (<xref ref-type="bibr" rid="B121">Toke, 2005</xref>).</p>
<p>Nevertheless, studies have demonstrated that high levels of hydrophobicity can lead to peptide aggregation and precipitation; hence, increased hydrophobicity can decrease the peptide&#x2019;s antimicrobial activity (<xref ref-type="bibr" rid="B148">Zou et al., 2018</xref>). Studies show a much more direct correlation between hydrophobicity and hemolytic activity (<xref ref-type="bibr" rid="B24">Chang et al., 2017</xref>; <xref ref-type="bibr" rid="B101">Parente et al., 2018</xref>). Hydrophobicity changes caused differences in the peptide&#x2019;s ability to insert into electrically neutral membranes (<xref ref-type="bibr" rid="B37">Dathe et al., 1996</xref>; <xref ref-type="bibr" rid="B133">Wieprecht et al., 1997</xref>).</p>
<p>Hydrophobicity, as already mentioned, is important for the interaction of AMPs with cytoplasmic membranes. So, it is likely that an increased hydrophobicity enables the peptide interaction with membranes with no selectivity, which can lead to toxicity towards mammalian cells. However, there are controversies regarding the correlation between hydrophobicity and hemolysis. In a study with two analog peptides from Stigmurin, an AMP from the scorpion <italic>T. stigmurus</italic>, the native peptide, which presented higher hydrophobicity than the analogs, showed no hemolysis, but the analog peptides showed hemolysis rate up to 30% at the tested concentrations (<xref ref-type="bibr" rid="B40">Melo et al., 2015</xref>; <xref ref-type="bibr" rid="B101">Parente et al., 2018</xref>) (<xref ref-type="table" rid="T1">Tables 1</xref>, <xref ref-type="table" rid="T2">2</xref>). Thereby, hydrophobicity is an important peptide feature related to its activity and toxicity, although the increased antimicrobial activity caused by the increment in hydrophobicity may be related to the chemical characteristics and composition of AMPs.</p>
<table-wrap id="T1" position="float">
<label>TABLE 1</label>
<caption>
<p>Physicochemical characteristics of native antimicrobial peptides and scorpion analogs.</p>
</caption>
<table>
<thead valign="top">
<tr>
<th align="left">Scorpion</th>
<th align="center">Native peptide</th>
<th align="center">H</th>
<th align="center">&#xb5;H</th>
<th align="center">Z</th>
<th align="center">Analog peptide<xref ref-type="table-fn" rid="Tfn1">
<sup>a</sup>
</xref>
</th>
<th align="center">Residue substitution</th>
<th align="center">H</th>
<th align="center">&#xb5;H</th>
<th align="center">Z</th>
<th align="center">References</th>
</tr>
</thead>
<tbody valign="top">
<tr>
<td rowspan="4" align="left">
<italic>Tityus stigmurus</italic>
</td>
<td rowspan="4" align="left">
<bold>Stigmurin</bold> FFSLIPSLVGGLISAFK-NH<sub>2</sub>
</td>
<td rowspan="4" align="center">0.89<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td rowspan="4" align="center">0.57</td>
<td rowspan="4" align="center">&#x2b;2</td>
<td align="left">
<bold>StigA6</bold> FFSLIP<bold>
<underline>K</underline>
</bold>LV<bold>
<underline>K</underline>
</bold>GLISAFK-NH<sub>2</sub>
</td>
<td rowspan="2" align="left">Ser and Gly by Lys</td>
<td align="center">0.78<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">0.66</td>
<td align="center">&#x2b;3</td>
<td rowspan="2" align="left">
<xref ref-type="bibr" rid="B101">Parente et al. (2018)</xref>
</td>
</tr>
<tr>
<td align="left">
<bold>StigA16</bold> FF<bold>
<underline>K</underline>
</bold>LIP<bold>
<underline>K</underline>
</bold>LV<bold>
<underline>K</underline>
</bold>GLISAFK-NH<sub>2</sub>
</td>
<td align="center">0.72<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">0.72</td>
<td align="center">&#x2b;4</td>
</tr>
<tr>
<td align="left">
<bold>StigA25</bold> FFSLIPSLV<bold>
<underline>KK</underline>
</bold>LI<bold>
<underline>K</underline>
</bold>AFK-NH<sub>2</sub>
</td>
<td align="left">Ser and Gly by Lys</td>
<td align="center">0.73</td>
<td align="center">0.70</td>
<td align="center">&#x2b;5</td>
<td rowspan="2" align="left">
<xref ref-type="bibr" rid="B6">Amorim-Carmo et al. (2019)</xref>
</td>
</tr>
<tr>
<td align="left">
<bold>StigA31</bold> FF<bold>
<underline>K</underline>
</bold>LIP<bold>
<underline>K</underline>
</bold>LV<bold>
<underline>KK</underline>
</bold>LI<bold>
<underline>K</underline>
</bold>AFK-NH<sub>2</sub>
</td>
<td align="left">Ser and Gly by Lys</td>
<td align="center">0.61</td>
<td align="center">0.80</td>
<td align="center">&#x2b;7</td>
</tr>
<tr>
<td rowspan="7" align="left">
<italic>Vaejovis mexicanus smithi</italic>
</td>
<td rowspan="7" align="left">
<bold>VmCT1</bold> FLGALWNVAKSVF</td>
<td rowspan="7" align="center">0.82</td>
<td rowspan="7" align="center">0.58</td>
<td rowspan="7" align="center">&#x2b;2</td>
<td align="left">
<bold>[K]</bold>
<sup>
<bold>3</bold>
</sup>
<bold>-VmCT1-NH</bold>
<sub>
<bold>2</bold>
</sub> FL<bold>
<underline>K</underline>
</bold>ALWNVAKSVF</td>
<td align="left">Gly by Lys</td>
<td align="center">0.74</td>
<td align="center">0.64</td>
<td align="center">&#x2b;3</td>
<td rowspan="7" align="left">
<xref ref-type="bibr" rid="B102">Pedron et al. (2017)</xref>
</td>
</tr>
<tr>
<td align="left">
<bold>[K]</bold>
<sup>
<bold>7</bold>
</sup>
<bold>-VmCT1-NH</bold>
<sub>
<bold>2</bold>
</sub> FLGALW<bold>
<underline>K</underline>
</bold>VAKSVF</td>
<td align="left">Asn by Lys</td>
<td align="center">0.79</td>
<td align="center">0.60</td>
<td align="center">&#x2b;3</td>
</tr>
<tr>
<td align="left">
<bold>[K]</bold>
<sup>
<bold>11</bold>
</sup>
<bold>-VmCT1-NH</bold>
<sub>
<bold>2</bold>
</sub> FLGALWNVAK<bold>
<underline>K</underline>
</bold>VF</td>
<td align="left">Ser by Lys</td>
<td align="center">0.75</td>
<td align="center">0.63</td>
<td align="center">&#x2b;3</td>
</tr>
<tr>
<td align="left">
<bold>[E]</bold>
<sup>
<bold>4</bold>
</sup>
<bold>-VmCT1-NH</bold>
<sub>
<bold>2</bold>
</sub> FLG<bold>
<underline>E</underline>
</bold>LWNVAKSVF</td>
<td align="left">Ala by Glu</td>
<td align="center">0.75</td>
<td align="center">0.61</td>
<td align="center">&#x2b;1</td>
</tr>
<tr>
<td align="left">
<bold>[E]</bold>
<sup>
<bold>7</bold>
</sup>
<bold>-VmCT1-NH</bold>
<sub>
<bold>2</bold>
</sub> FLGALW<bold>
<underline>E</underline>
</bold>VAKSVF</td>
<td align="left">Asn by Glu</td>
<td align="center">0.82</td>
<td align="center">0.58</td>
<td align="center">&#x2b;1</td>
</tr>
<tr>
<td align="left">
<bold>[W]</bold>
<sup>
<bold>9</bold>
</sup>
<bold>-VmCT1-NH</bold>
<sub>
<bold>2</bold>
</sub> FLGALWNV<bold>
<underline>W</underline>
</bold>KSVF</td>
<td align="left">Ala by Trp</td>
<td align="center">0.97</td>
<td align="center">0.72</td>
<td align="center">&#x2b;2</td>
</tr>
<tr>
<td align="left">
<bold>[E]</bold>
<sup>
<bold>4</bold>
</sup>
<bold>[W]</bold>
<sup>
<bold>9</bold>
</sup>
<bold>-VmCT1-NH</bold>
<sub>
<bold>2</bold>
</sub> FLG<bold>
<underline>E</underline>
</bold>LWNV<bold>
<underline>W</underline>
</bold>KSVF</td>
<td align="left">Ala by Glu and Trp</td>
<td align="center">0.90</td>
<td align="center">0.76</td>
<td align="center">&#x2b;1</td>
</tr>
<tr>
<td rowspan="6" align="left">
<italic>Buthus martensii</italic> Karsh</td>
<td rowspan="4" align="left">
<bold>BmKn2</bold> FIGAIARLLSKIF-NH<sub>2</sub>
</td>
<td rowspan="4" align="center">0.84<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td rowspan="4" align="center">0.76<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td rowspan="4" align="center">&#x2b;2<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="left">
<bold>BmKn2K7</bold> FIGAIA<bold>
<underline>K</underline>
</bold>LL<bold>
<underline>K</underline>
</bold>KIF-NH<sub>2</sub>
</td>
<td align="left">Arg and Ser by Lys</td>
<td align="center">0.77<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">0.80<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">&#x2b;3<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td rowspan="6" align="left">
<xref ref-type="bibr" rid="B12">de la Salud Bea et al. (2015)</xref>
</td>
</tr>
<tr>
<td align="left">
<bold>BmKn2L1</bold> FIGA<bold>
<underline>L</underline>
</bold>ARL<bold>
<underline>L</underline>
</bold>SKIF-NH<sub>2</sub>
</td>
<td align="left">Arg by Leu</td>
<td align="center">0.83<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">0.75<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">&#x2b;2<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
</tr>
<tr>
<td align="left">
<bold>BmKn2V1</bold> FIGA<bold>
<underline>V</underline>
</bold>ARL<bold>
<underline>V</underline>
</bold>SKIF-NH<sub>2</sub>
</td>
<td align="left">Ile and Leu by Val</td>
<td align="center">0.76<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">0.68<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">&#x2b;2<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
</tr>
<tr>
<td align="left">
<bold>BmKn2A1</bold> FIGA<bold>
<underline>A</underline>
</bold>ARL<bold>
<underline>A</underline>
</bold>SKIF-NH<sub>2</sub>
</td>
<td align="left">Ile and Leu by Ala</td>
<td align="center">0.62<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">0.55<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">&#x2b;2<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
</tr>
<tr>
<td rowspan="2" align="left">
<bold>BmKn1</bold> FIGAVAGLLSKIF-NH<sub>2</sub>
</td>
<td rowspan="2" align="center">0.87<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td rowspan="2" align="center">0.63<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td rowspan="2" align="center">&#x2b;1<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="left">
<bold>BmKn1-6Lys</bold> FIGAV<bold>
<underline>K</underline>
</bold>GLLSKIF-NH<sub>2</sub>
</td>
<td align="left">Ala by Lys</td>
<td align="center">0.77<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">0.64<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">&#x2b;2<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
</tr>
<tr>
<td align="left">
<bold>BmKn1L2K2</bold> F<bold>
<underline>K</underline>
</bold>GA<bold>
<underline>L</underline>
</bold>AGL<bold>
<underline>L</underline>
</bold>SK<bold>
<underline>K</underline>
</bold>F-NH<sub>2</sub>
</td>
<td align="left">Ile and Val by Leu and Lys</td>
<td align="center">0.48<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">0.35<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">&#x2b;3<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
</tr>
<tr>
<td rowspan="3" align="left">
<italic>Androctonus amoeruxi</italic>
</td>
<td rowspan="3" align="left">
<bold>AamAP1</bold> FLFSLIPHAIGGLISAFK-NH<sub>2</sub>
</td>
<td rowspan="3" align="center">0.90</td>
<td rowspan="3" align="center">0.43</td>
<td rowspan="3" align="center">&#x2b;1</td>
<td align="left">
<bold>AamAP-S1</bold> FLFSLIP<bold>
<underline>K</underline>
</bold>AIGGLISAFK-NH<sub>2</sub>
</td>
<td align="left">His by Lys</td>
<td align="center">0.84<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">0.49<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">&#x2b;2<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="left">
<xref ref-type="bibr" rid="B5">Almaaytah et al. (2012)</xref>
</td>
</tr>
<tr>
<td align="left">
<bold>A3</bold> FLFSLI<bold>
<underline>RK</underline>
</bold>AIGGLISAFK</td>
<td align="left">Pro and His by Arg and Lys</td>
<td align="center">0.74</td>
<td align="center">0.51</td>
<td align="center">&#x2b;3</td>
<td align="left">
<xref ref-type="bibr" rid="B3">Almaaytah et al. (2018)</xref>
</td>
</tr>
<tr>
<td align="left">
<bold>AamAP1-Lysine</bold> FLF<bold>
<underline>K</underline>
</bold>LIP<bold>
<underline>K</underline>
</bold>AI<bold>
<underline>KK</underline>
</bold>LIS<bold>
<underline>K</underline>
</bold>FK</td>
<td align="left">Ser, His, Gly, and Ala by Lys</td>
<td align="center">0.61</td>
<td align="center">0.61</td>
<td align="center">&#x2b;6</td>
<td align="left">
<xref ref-type="bibr" rid="B4">Almaaytah et al. (2014)</xref>
</td>
</tr>
<tr>
<td rowspan="7" align="left">
<italic>Opithancatus madagascariensis</italic>
</td>
<td rowspan="5" align="left">
<bold>IsCT1</bold> ILGKIWEGIKSLF-NH<sub>2</sub>
</td>
<td rowspan="5" align="center">0.78<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td rowspan="5" align="center">0.77<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td rowspan="5" align="center">&#x2b;1<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="left">
<bold>IsCT1A1</bold> ILGK<bold>
<underline>A</underline>
</bold>WEG<bold>
<underline>A</underline>
</bold>KSLF-NH<sub>2</sub>
</td>
<td align="left">Ile by Lys</td>
<td align="center">0.55<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">0.56<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">&#x2b;1<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td rowspan="7" align="left">
<xref ref-type="bibr" rid="B39">de la Salud Bea et al. (2017)</xref>
</td>
</tr>
<tr>
<td align="left">
<bold>IsCT1V1</bold> ILGK<bold>
<underline>V</underline>
</bold>WEG<bold>
<underline>V</underline>
</bold>KSLF-NH<sub>2</sub>
</td>
<td align="left">Ile by Val</td>
<td align="center">0.69<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">0.69<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">&#x2b;1<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
</tr>
<tr>
<td align="left">
<bold>IsCT1L1</bold> ILGK<bold>
<underline>L</underline>
</bold>WEG<bold>
<underline>L</underline>
</bold>KSLF-NH<sub>2</sub>
</td>
<td align="left">Ile by Leu</td>
<td align="center">0.76<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">0.76<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">&#x2b;1<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
</tr>
<tr>
<td align="left">
<bold>IsCT1K7</bold> ILGKIW<bold>
<underline>K</underline>
</bold>GIKSLF-NH<sub>2</sub>
</td>
<td align="left">Glu by Lys</td>
<td align="center">0.75<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">0.80<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">&#x2b;3<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
</tr>
<tr>
<td align="left">
<bold>IsCT1E7</bold> ILGKIWEGI<bold>
<underline>E</underline>
</bold>SLF-NH<sub>2</sub>
</td>
<td align="left">Lys by Glu</td>
<td align="center">0.71<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">0.76<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">&#x2212;1<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
</tr>
<tr>
<td rowspan="2" align="left">
<bold>IsCT2</bold> IFGAIWNGIKSLF</td>
<td rowspan="2" align="center">0.89<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td rowspan="2" align="center">0.71<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td rowspan="2" align="center">&#x2b;1<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="left">
<bold>IsCT2A1</bold> ILGA<bold>
<underline>A</underline>
</bold>WNG<bold>
<underline>A</underline>
</bold>KSLF-NH<sub>2</sub>
</td>
<td align="left">Ile by Ala</td>
<td align="center">0.65<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">0.49<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">&#x2b;1<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
</tr>
<tr>
<td align="left">
<bold>IsCT2V1</bold> ILGA<bold>
<underline>V</underline>
</bold>WNG<bold>
<underline>V</underline>
</bold>KSLF-NH<sub>2</sub>
</td>
<td align="left">Ile by Val</td>
<td align="center">0.79<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">0.62<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">&#x2b;1<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
</tr>
<tr>
<td rowspan="2" align="left">
<italic>Tityus serrulatus</italic>
</td>
<td align="left">
<bold>TsAP-1</bold> FLSLIPSLVGGSISAFK-NH<sub>2</sub>
</td>
<td align="center">0.78<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">0.43</td>
<td align="center">&#x2b;2</td>
<td align="left">
<bold>TsAP-S1</bold> FLSLIP<bold>K</bold>LV<bold>KK</bold>II<bold>K</bold>AFK-NH<sub>2</sub>
</td>
<td align="left">Ser, Ile, and Gly by Lys</td>
<td align="center">0.66<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">0.75</td>
<td align="center">&#x2b;6</td>
<td rowspan="2" align="left">
<xref ref-type="bibr" rid="B62">Guo et al. (2013)</xref>
</td>
</tr>
<tr>
<td align="left">
<bold>TsAP-2</bold> FLGMIPGLIGGLISAFK- NH<sub>2</sub>
</td>
<td align="center">0.90<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">0.51</td>
<td align="center">&#x2b;2</td>
<td align="left">
<bold>TsAP-S2</bold> FLGMIP<bold>
<underline>K</underline>
</bold>LI<bold>
<underline>KK</underline>
</bold>LI<bold>
<underline>K</underline>
</bold>AFK-NH<sub>2</sub>
</td>
<td align="left">Ser and Gly by Lys</td>
<td align="center">0.67<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">0.73</td>
<td align="center">&#x2b;6</td>
</tr>
<tr>
<td rowspan="6" align="left">
<italic>Heterometrus petersii</italic>
</td>
<td rowspan="6" align="left">
<bold>Hp1404</bold> GILGKLWEGVKSIF-NH<sub>2</sub>
</td>
<td rowspan="6" align="center">0.68<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td rowspan="6" align="center">0.67</td>
<td rowspan="6" align="center">&#x2b;1</td>
<td align="left">
<bold>Hp1404-T1</bold> ILGKLWEGVKSI-NH<sub>2</sub>
</td>
<td align="left">Removal of Gly and Phe</td>
<td align="center">0.65<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">0.69</td>
<td align="center">&#x2b;1</td>
<td rowspan="6" align="left">
<xref ref-type="bibr" rid="B71">Kim et al. (2018)</xref>
</td>
</tr>
<tr>
<td align="left">
<bold>Hp1404-T1a</bold> IL<bold>
<underline>K</underline>
</bold>KLWEGVKSI-NH<sub>2</sub>
</td>
<td align="left">Gly by Lys</td>
<td align="center">0.58<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">0.76</td>
<td align="center">&#x2b;2</td>
</tr>
<tr>
<td align="left">
<bold>Hp1404-T1b</bold> ILKKL<bold>
<underline>L</underline>
</bold>EGVKSI-NH<sub>2</sub>
</td>
<td align="left">Trp by Leu</td>
<td align="center">0.52<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">0.75</td>
<td align="center">&#x2b;2</td>
</tr>
<tr>
<td align="left">
<bold>Hp1404-T1c</bold> ILKKLL<bold>
<underline>K</underline>
</bold>GVKSI-NH<sub>2</sub>
</td>
<td align="left">Glu by Lys</td>
<td align="center">0.49<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">0.78</td>
<td align="center">&#x2b;4</td>
</tr>
<tr>
<td align="left">
<bold>Hp1404-T1d</bold> ILKKLLK<bold>
<underline>K</underline>
</bold>VKSI-NH<sub>2</sub>
</td>
<td align="left">Gly by Lys</td>
<td align="center">0.41<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">0.76</td>
<td align="center">&#x2b;5</td>
</tr>
<tr>
<td align="left">
<bold>Hp1404-T1e</bold> ILKKLLKKVK<bold>
<underline>K</underline>
</bold>I-NH<sub>2</sub>
</td>
<td align="left">Ser by Lys</td>
<td align="center">0.33<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">0.83</td>
<td align="center">&#x2b;6</td>
</tr>
<tr>
<td rowspan="2" align="left">
<italic>Androctonus crassicauda</italic>
</td>
<td align="left">
<bold>AcrAP1</bold> FLFSLIPHAISGLISAFK</td>
<td align="center">0.90</td>
<td align="center">0.43</td>
<td align="center">&#x2b;2</td>
<td align="left">
<bold>AcrAP1a</bold> FLF<bold>
<underline>K</underline>
</bold>LIP<bold>
<underline>K</underline>
</bold>AI<bold>
<underline>K</underline>
</bold>GLI<bold>
<underline>K</underline>
</bold>AFK</td>
<td align="left">Ser and His by Lys</td>
<td align="center">0.68</td>
<td align="center">0.64</td>
<td align="center">&#x2b;6</td>
<td rowspan="2" align="left">
<xref ref-type="bibr" rid="B48">Du et al. (2014)</xref>
</td>
</tr>
<tr>
<td align="left">
<bold>AcrAP2</bold> FLFSLIPNAISGLLSAFK</td>
<td align="center">0.85</td>
<td align="center">0.47</td>
<td align="center">&#x2b;2</td>
<td align="left">
<bold>AcrAP2a</bold> FLF<bold>
<underline>K</underline>
</bold>LIP<bold>
<underline>K</underline>
</bold>AI<bold>
<underline>K</underline>
</bold>GLL<bold>
<underline>K</underline>
</bold>AFK</td>
<td align="left">Ser and Asn by Lys</td>
<td align="center">0.67</td>
<td align="center">0.63</td>
<td align="center">&#x2b;6</td>
</tr>
<tr>
<td rowspan="2" align="left">
<italic>Pandinus imperator</italic>
</td>
<td rowspan="2" align="left">
<bold>Pin2</bold> FWGALAKGALKLIPSLFSSFSKKD</td>
<td rowspan="2" align="center">0.54<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td rowspan="2" align="center">0.48</td>
<td rowspan="2" align="center">&#x2b;3</td>
<td align="left">
<bold>Pin2 [G]</bold> FWGALAKGALKLI<bold>
<underline>G</underline>
</bold>SLFSSFSKKD</td>
<td align="left">Pro by Gly</td>
<td align="center">0.51<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">0.49</td>
<td align="center">&#x2b;3</td>
<td rowspan="2" align="left">
<xref ref-type="bibr" rid="B107">Rodr&#xed;guez et al. (2014)</xref>
</td>
</tr>
<tr>
<td align="left">
<bold>Pin2 [GPG]</bold> FWGALAKGALKLI<bold>
<underline>GPG</underline>
</bold>SLFSSFSKKD</td>
<td align="left">Addition and substitution of Pro, Ser, and Leu by Gly and Pro</td>
<td align="center">0.49<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">0.28</td>
<td align="center">&#x2b;3</td>
</tr>
<tr>
<td rowspan="2" align="left">
<italic>Androctonus aeneas</italic>
</td>
<td align="left">
<bold>AaeAP1</bold> FLFSLIPSVIAGLVSAIRN</td>
<td align="center">0.84</td>
<td align="center">0.45</td>
<td align="center">&#x2b;2</td>
<td align="left">
<bold>AaeAP1a</bold> FLF<bold>
<underline>K</underline>
</bold>LIP<bold>
<underline>KA</underline>
</bold>I<bold>
<underline>K</underline>
</bold>GLV<bold>
<underline>K</underline>
</bold>AIR<bold>
<underline>K</underline>
</bold>
</td>
<td align="left">Ser, Ala, and Asn by Ala and Lys</td>
<td align="center">0.61</td>
<td align="center">0.66</td>
<td align="center">&#x2b;7</td>
<td rowspan="2" align="left">
<xref ref-type="bibr" rid="B49">Du et al. (2015)</xref>
</td>
</tr>
<tr>
<td align="left">
<bold>AaeAP2</bold> FLFSLIPSAIAGLVSAIRN</td>
<td align="center">0.80</td>
<td align="center">0.42</td>
<td align="center">&#x2b;2</td>
<td align="left">
<bold>AaeAP2a</bold> FLF<bold>
<underline>K</underline>
</bold>LIP<bold>
<underline>KV</underline>
</bold>I<bold>
<underline>K</underline>
</bold>GLV<bold>
<underline>K</underline>
</bold>AIR<bold>
<underline>K</underline>
</bold>
</td>
<td align="left">Ser, Ala, and Asn by Val and Lys</td>
<td align="center">0.56</td>
<td align="center">0.64</td>
<td align="center">&#x2b;7</td>
</tr>
<tr>
<td rowspan="2" align="left">
<italic>Didymocentrus krausi</italic>
</td>
<td rowspan="2" align="left">
<bold>MK049518</bold> FLGLLGSVLGSVLPSIFK-NH<sub>2</sub>
</td>
<td rowspan="2" align="center">0.88<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td rowspan="2" align="center">0.46<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td rowspan="2" align="center">&#x2b;1</td>
<td align="left">
<bold>S3K</bold> FLGLLG<bold>
<underline>K</underline>
</bold>VLG<bold>
<underline>K</underline>
</bold>VLP<bold>
<underline>K</underline>
</bold>IFK-NH<sub>2</sub>
</td>
<td align="left">Ser by Lys</td>
<td align="center">0.72<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">0.57<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">&#x2b;4</td>
<td rowspan="2" align="left">
<xref ref-type="bibr" rid="B81">Li et al. (2020)</xref>
</td>
</tr>
<tr>
<td align="left">
<bold>G2K&#x2013;S3K</bold> FL<bold>
<underline>K</underline>
</bold>LL<bold>
<underline>KK</underline>
</bold>VL<bold>
<underline>KK</underline>
</bold>VLP<bold>
<underline>K</underline>
</bold>IFK-NH<sub>2</sub>
</td>
<td align="left">Ser and Gly by Lys</td>
<td align="center">0.56<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">0.62<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td align="center">&#x2b;7</td>
</tr>
<tr>
<td rowspan="3" align="left">
<italic>Vejovis mexicanus</italic> and <italic>Hadrurus gertschi</italic>
</td>
<td rowspan="3" align="left">
<bold>Vejovine</bold> GIWSSIKNLASKAWNSDIGQSLRNKAAGAINKFVADKIGVTPSQAAS and <bold>Hadrurin</bold> GILDTIKSIASKVWNSKTVQDLKRKGINWVANKLGVSPQAA</td>
<td rowspan="3" align="center">0,29<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref> and 0,32<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td rowspan="3" align="center">0,081<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref> and 0,13<xref ref-type="table-fn" rid="Tfn2">
<sup>b</sup>
</xref>
</td>
<td rowspan="3" align="center">&#x2b;4 and &#x2b;5</td>
<td align="left">
<bold>&#x394;(A29)</bold> GILKTIKSIASKVANTVQ<bold>
<underline>KLKRK</underline>
</bold>AKNAV</td>
<td align="left">Sequence combination</td>
<td align="center">0,17</td>
<td align="center">0,50</td>
<td align="center">&#x2b;8</td>
<td rowspan="3" align="left">
<xref ref-type="bibr" rid="B109">S&#xe1;nchez-V&#xe1;squez et al. (2013)</xref>
</td>
</tr>
<tr>
<td align="left">
<bold>&#x394; (K12-Q18; N26-A29)</bold> GILKTIKSIAS<bold>
<underline>KLKRK</underline>
</bold>AK</td>
<td align="left">Sequence combination</td>
<td align="center">0,27</td>
<td align="center">0,63</td>
<td align="center">&#x2b;6</td>
</tr>
<tr>
<td align="left">
<bold>K4N &#x394; (K12-Q18; N26-A29)</bold> GILNTIKSIAS<bold>
<underline>KLKRK</underline>
</bold>AK</td>
<td align="left">Sequence combination</td>
<td align="center">0,29</td>
<td align="center">0,61</td>
<td align="center">&#x2b;5</td>
</tr>
</tbody>
</table>
<table-wrap-foot>
<fn>
<p>H, hydrophobicity; &#xb5;H, hydrophobicity moment; Z, net charge.</p>
</fn>
<fn id="Tfn1">
<label>a</label>
<p>Modifications in analog peptides are marked in bold.</p>
</fn>
<fn id="Tfn2">
<label>b</label>
<p>Not calculated by the authors of the studies (calculated here using the HeliQuest server).</p>
</fn>
</table-wrap-foot>
</table-wrap>
<table-wrap id="T2" position="float">
<label>TABLE 2</label>
<caption>
<p>Comparison of hemolytic and antimicrobial activities of native scorpion peptides and their analogs after modifications.</p>
</caption>
<table>
<thead valign="top">
<tr>
<th align="left">Native peptide</th>
<th align="center">Hemolytic activity<xref ref-type="table-fn" rid="Tfn3">
<sup>a</sup>
</xref>
</th>
<th align="center">MIC</th>
<th align="center">Analog peptide</th>
<th align="center">Hemolytic activity<xref ref-type="table-fn" rid="Tfn3">
<sup>a</sup>
</xref> (&#x223c;30%)</th>
<th align="center">MIC</th>
<th align="center">Strains</th>
<th align="center">References</th>
</tr>
</thead>
<tbody valign="top">
<tr>
<td rowspan="4" align="left">Stigmurin</td>
<td rowspan="4" align="left">1.17% in 75&#xa0;&#xb5;M</td>
<td rowspan="4" align="left">&#x3e;150; 9.3 and 37.5&#xa0;&#xb5;M</td>
<td align="left">StigA6</td>
<td align="left">30% in 75&#xa0;&#xb5;M</td>
<td align="left">4.6; 2.3 and 9.3&#xa0;&#xb5;M</td>
<td rowspan="2" align="left">
<italic>E. coli</italic>, <italic>S. aureus</italic>, and <italic>C. albicans</italic>, respectively</td>
<td rowspan="2" align="left">
<xref ref-type="bibr" rid="B101">Parente et al. (2018)</xref>
</td>
</tr>
<tr>
<td align="left">StigA16</td>
<td align="left">30% in 75&#xa0;&#xb5;M</td>
<td align="left">2.3; 2.3 and 4.6&#xa0;&#xb5;M</td>
</tr>
<tr>
<td align="left">StigA25</td>
<td align="left">30% in 18.8&#xa0;&#xb5;M</td>
<td align="left">2.3; 1.2 and 9.4&#xa0;&#xb5;M</td>
<td rowspan="2" align="left">
<italic>E. coli</italic>, <italic>S. aureus</italic>, and <italic>C. albicans</italic>, respectively</td>
<td rowspan="2" align="left">
<xref ref-type="bibr" rid="B6">Amorim-Carmo et al. (2019)</xref>
</td>
</tr>
<tr>
<td align="left">StigA31</td>
<td align="left">30% in 18.8&#xa0;&#xb5;M</td>
<td align="left">1.2; 2.3 and 4.7&#xa0;&#xb5;M</td>
</tr>
<tr>
<td rowspan="7" align="left">VmCT1</td>
<td rowspan="7" align="left">Not calculated for 30%</td>
<td rowspan="7" align="left">0.78; 3.12 and 12.5&#xa0;&#xb5;M</td>
<td align="left">[K]3-VmCT1-NH2</td>
<td align="left">Not calculated for 30%</td>
<td align="left">0.39; 3.12 and 3.12&#xa0;&#xb5;M</td>
<td rowspan="7" align="left">
<italic>P. aeruginosa</italic>, <italic>S. aureus</italic>, and <italic>C. albicans</italic>, respectively</td>
<td rowspan="7" align="left">
<xref ref-type="bibr" rid="B102">Pedron et al. (2017)</xref>
</td>
</tr>
<tr>
<td align="left">[K]7-VmCT1-NH2</td>
<td align="left">Not calculated for 30%</td>
<td align="left">0.39; 1.56 and 1.56&#xa0;&#xb5;M</td>
</tr>
<tr>
<td align="left">[K]11-VmCT1-NH2</td>
<td align="left">Not calculated for 30%</td>
<td align="left">0.39; 1.56 and 1.56&#xa0;&#xb5;M</td>
</tr>
<tr>
<td align="left">[E]4-VmCT1-NH2</td>
<td align="left">Not calculated for 30%</td>
<td align="left">3.12; 50 and 50&#xa0;&#xb5;M</td>
</tr>
<tr>
<td align="left">[E]7-VmCT1-NH2</td>
<td align="left">Not calculated for 30%M</td>
<td align="left">0.78; 6.25 and 12.5&#xa0;&#xb5;M</td>
</tr>
<tr>
<td align="left">[W]9-VmCT1-NH2</td>
<td align="left">Not calculated for 30%</td>
<td align="left">0.78; 1.56 and 1.56&#xa0;&#xb5;M</td>
</tr>
<tr>
<td align="left">[E]4[W]9-VmCT1-NH2</td>
<td align="left">1.6&#xa0;&#xb5;M</td>
<td align="left">3.12; 12.5 and 6.25&#xa0;&#xb5;M</td>
</tr>
<tr>
<td rowspan="3" align="left">AamAP1</td>
<td rowspan="3" align="left">&#x223c;30% in 100&#xa0;&#xb5;M</td>
<td align="left">150; 20 and 64&#xa0;&#xb5;M</td>
<td align="left">AamAP-S1</td>
<td align="left">&#x223c;30% in 40&#xa0;&#xb5;M</td>
<td align="left">5; 3 and 5&#xa0;&#xb5;M</td>
<td align="left">
<italic>E. coli</italic>, <italic>S. aureus</italic>, and <italic>C. albicans</italic>, respectively</td>
<td align="left">
<xref ref-type="bibr" rid="B5">Almaaytah et al. (2012)</xref>
</td>
</tr>
<tr>
<td align="left">20&#xa0;&#xb5;M</td>
<td align="left">A3</td>
<td align="left">&#x223c;30% in 40&#xa0;&#xb5;M</td>
<td align="left">5&#xa0;&#xb5;M</td>
<td align="left">
<italic>S. aureus</italic>
</td>
<td align="left">
<xref ref-type="bibr" rid="B3">Almaaytah et al. (2018)</xref>
</td>
</tr>
<tr>
<td align="left">20 and 150&#xa0;&#xb5;M</td>
<td align="left">AamAP1-Lysine</td>
<td align="left">&#x223c;30% in 80&#xa0;&#xb5;M</td>
<td align="left">5 and 7.5&#xa0;&#xb5;M</td>
<td align="left">
<italic>S. aureus</italic> and <italic>E. coli</italic>, respectively</td>
<td align="left">
<xref ref-type="bibr" rid="B4">Almaaytah et al. (2014)</xref>
</td>
</tr>
<tr>
<td rowspan="5" align="left">IsCT1</td>
<td rowspan="5" align="left">30% in &#x223c;20&#xa0;&#x3bc;g/ml</td>
<td rowspan="5" align="left">50; &#x3e;100 and 50&#xa0;&#x3bc;g/ml</td>
<td align="left">IsCT1A1</td>
<td align="left">&#x223c;5% in 100&#xa0;&#x3bc;g/ml</td>
<td align="left">&#x3e;100; &#x3e;100 and &#x3e;100&#xa0;&#x3bc;g/ml</td>
<td rowspan="7" align="left">
<italic>S. aureus</italic>, <italic>B. cereus</italic>, and <italic>E. coli</italic>, respectively</td>
<td rowspan="7" align="left">
<xref ref-type="bibr" rid="B39">de la Salud Bea et al. (2017)</xref>
</td>
</tr>
<tr>
<td align="left">IsCT1V1</td>
<td align="left">&#x223c;5% in 100&#xa0;&#x3bc;g/ml</td>
<td align="left">&#x3e;100; &#x3e;100 and &#x3e;100&#xa0;&#x3bc;g/ml</td>
</tr>
<tr>
<td align="left">IsCT1L1</td>
<td align="left">30% in &#x223c;20&#xa0;&#x3bc;g/ml</td>
<td align="left">50; &#x3e;100 and 50</td>
</tr>
<tr>
<td align="left">IsCT1K7</td>
<td align="left">30% in &#x223c;30&#xa0;&#x3bc;g/ml</td>
<td align="left">100; &#x3e;100 and &#x3e;100&#xa0;&#x3bc;g/ml</td>
</tr>
<tr>
<td align="left">IsCT1E7</td>
<td align="left">0% in 100&#xa0;&#x3bc;g/ml</td>
<td align="left">&#x3e;100; &#x3e;100 and &#x3e;100&#xa0;&#x3bc;g/ml</td>
</tr>
<tr>
<td rowspan="2" align="left">IsCT2</td>
<td rowspan="2" align="left">30% in &#x223c;20&#xa0;&#x3bc;g/ml</td>
<td rowspan="2" align="left">50; 100 and 50&#xa0;&#x3bc;g/ml</td>
<td align="left">IsCT2A1</td>
<td align="left">&#x223c;5% in 100&#xa0;&#x3bc;g/ml</td>
<td align="left">&#x3e;100; &#x3e;100 and &#x3e;100&#xa0;&#x3bc;g/ml</td>
</tr>
<tr>
<td align="left">IsCT2V1</td>
<td align="left">&#x223c;20% in 100&#xa0;&#x3bc;g/ml</td>
<td align="left">&#x3e;100; &#x3e;100 and &#x3e;100&#xa0;&#x3bc;g/ml</td>
</tr>
<tr>
<td align="left">TsAP-1</td>
<td align="left">&#x223c;5% in 160&#xa0;&#xb5;M</td>
<td align="left">120; 160 and 160&#xa0;&#xb5;M</td>
<td align="left">TsAP-S1</td>
<td align="left">30% in &#x223c;6&#xa0;&#xb5;M</td>
<td align="left">2.5; 5 and 2.5&#xa0;&#xb5;M</td>
<td rowspan="2" align="left">
<italic>S. aureus</italic>, <italic>E. coli</italic>, and <italic>C. albicans</italic>, respectively</td>
<td rowspan="2" align="left">
<xref ref-type="bibr" rid="B62">Guo et al. (2013)</xref>
</td>
</tr>
<tr>
<td align="left">TsAP-2</td>
<td align="left">30% in &#x223c;30&#xa0;&#xb5;M</td>
<td align="left">5; &#x3e;320 and 10&#xa0;&#xb5;M</td>
<td align="left">TsAP-S2</td>
<td align="left">30% in &#x223c;6&#xa0;&#xb5;M</td>
<td align="left">5; 5 and 2.5&#xa0;&#xb5;M</td>
</tr>
<tr>
<td rowspan="6" align="left">Hp1404</td>
<td rowspan="6" align="left">30% in &#x223c;40&#xa0;&#xb5;M</td>
<td rowspan="6" align="left">12.5&#xa0;&#xb5;M</td>
<td align="left">Hp1404-T1</td>
<td align="left">N/C</td>
<td align="left">&#x3e;25&#xa0;&#xb5;M</td>
<td rowspan="6" align="left">
<italic>P. aeruginosa</italic> ATCC 27853</td>
<td rowspan="6" align="left">
<xref ref-type="bibr" rid="B71">Kim et al. (2018)</xref>
</td>
</tr>
<tr>
<td align="left">Hp1404-T1a</td>
<td align="left">N/C</td>
<td align="left">&#x3e;25&#xa0;&#xb5;M</td>
</tr>
<tr>
<td align="left">Hp1404-T1b</td>
<td align="left">N/C</td>
<td align="left">&#x3e;25&#xa0;&#xb5;M</td>
</tr>
<tr>
<td align="left">Hp1404-T1c</td>
<td align="left">N/C</td>
<td align="left">3.13&#xa0;&#xb5;M</td>
</tr>
<tr>
<td align="left">Hp1404-T1d</td>
<td align="left">N/C</td>
<td align="left">1.56&#xa0;&#xb5;M</td>
</tr>
<tr>
<td align="left">Hp1404-T1e</td>
<td align="left">0% in 200&#xa0;&#xb5;M</td>
<td align="left">1.56&#xa0;&#xb5;M</td>
</tr>
<tr>
<td align="left">AcrAP1</td>
<td align="left">Not calculated for 30%</td>
<td align="left">8; &#x3e;250 and 16&#xa0;&#xb5;M</td>
<td align="left">AcrAP1a</td>
<td align="left">Not calculated for 30%</td>
<td align="left">4; 8 and 4&#xa0;&#xb5;M</td>
<td rowspan="2" align="left">
<italic>S. aureus</italic>, <italic>E. coli</italic>, and <italic>C. albicans</italic>, respectively</td>
<td rowspan="2" align="left">
<xref ref-type="bibr" rid="B48">Du et al. (2014)</xref>
</td>
</tr>
<tr>
<td align="left">AcrAP2</td>
<td align="left">Not calculated for 30%</td>
<td align="left">8; &#x3e;250 and 16&#xa0;&#xb5;M</td>
<td align="left">AcrAP2a</td>
<td align="left">Not calculated for 30%</td>
<td align="left">4; 8 and 4&#xa0;&#xb5;M</td>
</tr>
<tr>
<td rowspan="2" align="left">Pin2</td>
<td rowspan="2" align="left">30% in &#x223c;5 &#xb5;M</td>
<td rowspan="2" align="left">18.8 and 37.5&#xa0;&#xb5;M</td>
<td align="left">Pin2 [G]</td>
<td align="left">30% in &#x223c;2&#xa0;&#xb5;M</td>
<td align="left">12.5 and 12.5&#xa0;&#xb5;M</td>
<td rowspan="2" align="left">
<italic>E. coli</italic> and <italic>S. aureus</italic>, respectively</td>
<td rowspan="2" align="left">
<xref ref-type="bibr" rid="B107">Rodr&#xed;guez et al. (2014)</xref>
</td>
</tr>
<tr>
<td align="left">Pin2 [GPG]</td>
<td align="left">30% in &#x223c;25&#xa0;&#xb5;M</td>
<td align="left">25 and 25&#xa0;&#xb5;M</td>
</tr>
<tr>
<td align="left">AaeAP1</td>
<td align="left">Not calculated for 30%</td>
<td align="left">16; &#x3e;512 and 32&#xa0;mg/L</td>
<td align="left">AaeAP1a</td>
<td align="left">Not calculated for 30%</td>
<td align="left">4; 16 and 4&#xa0;mg/L</td>
<td rowspan="2" align="left">
<italic>S. aureus</italic>, <italic>E. coli</italic>, and <italic>C. albicans</italic>, respectively</td>
<td rowspan="2" align="left">
<xref ref-type="bibr" rid="B49">Du et al. (2015)</xref>
</td>
</tr>
<tr>
<td align="left">AaeAP2</td>
<td align="left">Not calculated for 30%</td>
<td align="left">16; &#x3e;512 and 32&#xa0;mg/L</td>
<td align="left">AaeAP2a</td>
<td align="left">Not calculated for 30%</td>
<td align="left">4; 1 and 4&#xa0;mg/L</td>
</tr>
<tr>
<td rowspan="2" align="left">MK049518</td>
<td rowspan="2" align="left">Not calculated</td>
<td rowspan="2" align="left">6.7; &#x3e;54.1 and &#x3e;54.1&#xa0;&#xb5;M</td>
<td align="left">S3K</td>
<td align="left">Not calculated</td>
<td align="left">1.5; 12.6 and 12.6&#xa0;&#xb5;M</td>
<td rowspan="2" align="left">
<italic>S. aureus</italic>, <italic>E. coli</italic>, and <italic>P. aeruginosa</italic>, respectively</td>
<td rowspan="2" align="left">
<xref ref-type="bibr" rid="B81">Li et al. (2020)</xref>
</td>
</tr>
<tr>
<td align="left">G2K&#x2013;S3K</td>
<td align="left">Not calculated</td>
<td align="left">1.4; 2.8 and 5.7&#xa0;&#xb5;M</td>
</tr>
</tbody>
</table>
<table-wrap-foot>
<fn id="Tfn3">
<label>a</label>
<p>30% of hemolysis was considered the maximum acceptable limit.</p>
</fn>
</table-wrap-foot>
</table-wrap>
</sec>
<sec id="s2-5">
<title>Hydrophobic Moment</title>
<p>Membrane-active peptides generally present two characteristics: they must be soluble in water to enable transport and to present hydrophobic residues to interact with the cytoplasmic membrane (<xref ref-type="bibr" rid="B36">Dathe and Wieprecht, 1999</xref>). Different from hydrophobicity, the hydrophobic moment (&#xb5;H) is the hydrophobicity of a peptide measured for different angles of rotation per residue; in other words, it is the quantification of the peptide amphipathicity, where a face of the peptide helix is hydrophilic and the other is hydrophobic (<xref ref-type="bibr" rid="B111">Segrest et al., 1990</xref>; <xref ref-type="bibr" rid="B27">Cherry et al., 2014</xref>).</p>
<p>AMPs usually present high hydrophobic moment and moderate hydrophobicity (<xref ref-type="bibr" rid="B129">Wallace et al., 2004</xref>). A more direct correlation between the hydrophobic moment and the antimicrobial activity is observed, so that when the hydrophobic moment increases, the antimicrobial activity increases (<xref ref-type="bibr" rid="B76">Lee et al., 2004</xref>; <xref ref-type="bibr" rid="B5">Almaaytah et al., 2012</xref>; <xref ref-type="bibr" rid="B38">la Salud Bea et al., 2015</xref>). One example is the study by la Salud Bea and contributors (2015) in which they designed 5 analog peptides from the AMP BmKn1 from the scorpion <italic>Buthus martensii</italic>, where the analog peptides with higher hydrophobic moments revealed increased antimicrobial activity. Similar results were found by Parente and collaborators (2018), where two peptide analogs studied with hydrophobic moments of 0.66 and 0.72 showed higher antimicrobial activity and a broader activity spectrum than the native peptide, which showed a hydrophobic moment of 0.57 (<xref ref-type="bibr" rid="B101">Parente et al., 2018</xref>).</p>
<p>Along these lines, we can observe that the hydrophobic moment is a feature that modulates AMPs&#x2019; activity through hydrophobic interactions between the peptide and bacterial membrane.</p>
</sec>
<sec id="s2-6">
<title>Net Charge</title>
<p>Despite the diverse nature of AMPs, the cationic character is a feature broadly found among them (<xref ref-type="bibr" rid="B50">Epand and Epand, 2011</xref>). The net charge is the sum of the charges from all ionizable groups of a peptide (<xref ref-type="bibr" rid="B9">Bahar and Ren, 2013</xref>). Gram-positive or Gram-negative bacterial membrane is negatively charged; therefore, the main role of the presence of cationic amino acids in AMPs is to interact with these membranes (<xref ref-type="bibr" rid="B7">Andersson et al., 2016</xref>). Electrostatic interactions between cationic peptides and anionic phospholipids present in the bacterial membrane play a major role in the recognition and selectivity of microbial surface (<xref ref-type="bibr" rid="B86">Malanovic and Lohner, 2016</xref>).</p>
<p>The net charge of AMPs can vary substantially from 0 to &#x2b;16. Although the net charge of most AMPs ranges within positive intermediate values, there are also reports of negatively charged AMPs. However, the net charge of most AMPs ranges from &#x2b;4 to &#x2b;6, with an average of &#x2b;2.26 for linear peptides, which may represent an optimal range for their activity (<xref ref-type="bibr" rid="B68">Huang et al., 2010</xref>; <xref ref-type="bibr" rid="B131">Wang et al., 2016</xref>). There are exceptions for this range, as the AMPs imcroporin and pandinins from <italic>Isometrus maculatus</italic> and <italic>P. imperator</italic>, respectively, both present a net charge of &#x2b;1 (<xref ref-type="bibr" rid="B147">Zhao et al., 2009</xref>; <xref ref-type="bibr" rid="B145">Zeng et al., 2013</xref>). It is known that the bacterial membrane is negatively charged and it is approximately 50% more negative than mammalian cell membranes (<xref ref-type="bibr" rid="B13">Benarroch and Asally, 2020</xref>). The charge difference in prokaryotic and eukaryotic cell membranes increases the selectivity of the cationic AMPs (<xref ref-type="bibr" rid="B69">Jenssen et al., 2006</xref>). To illustrate changes in charge distribution on the surface of AMPs, the peptide TsAP-1 from <italic>T. serrulatus</italic> with charge &#x2b;2 and its analog TsAP-S1 with charge &#x2b;6 were analyzed (<xref ref-type="fig" rid="F3">Figure 3</xref>) (<xref ref-type="bibr" rid="B62">Guo et al., 2013</xref>).</p>
<fig id="F3" position="float">
<label>FIGURE 3</label>
<caption>
<p>Antimicrobial peptides visualized using PyMol. <bold>(A,C)</bold> Peptide tridimensional view of TsAP-1 and TsAP-S1, respectively. <bold>(B,D)</bold> Different angles of the electrostatic surface created through Adaptive Poisson&#x2013;Boltzmann solver (APBS). The negatively charged surface is shown in red, the positively charged surface is shown in blue, and the neutrally charged surface is shown in white.</p>
</caption>
<graphic xlink:href="fmolb-09-887763-g003.tif"/>
</fig>
<p>The charge is directly related to the antimicrobial activity and regulates the balance between antimicrobial and hemolytic activities. A study observed that the antimicrobial activity was affected in the analogs of the AMP IsCT designed to be more negatively charged; however, cytotoxicity was not observed in the tested concentrations (<xref ref-type="bibr" rid="B39">de la Salud Bea et al., 2017</xref>). Moreover, anionic or acidic AMPs from scorpions are less commonly studied; however, they are present in all detected species, for instance, TanP from <italic>T. stigmurus</italic> and Hap-1 (<xref ref-type="bibr" rid="B116">Shi et al., 2018</xref>; <xref ref-type="bibr" rid="B41">Melo et al., 2021</xref>).</p>
</sec>
<sec id="s2-7">
<title>Polar Angle (<italic>&#x3b8;</italic>
<sub>
<italic>p</italic>
</sub>) and Hydrophobic Angle (<italic>&#x3b8;</italic>
<sub>
<italic>h</italic>
</sub>)</title>
<p>Polar (<italic>&#x3b8;</italic>
<sub>
<italic>p</italic>
</sub>) and hydrophobic (<italic>&#x3b8;</italic>
<sub>
<italic>h</italic>
</sub>) angles are defined by the polar and hydrophobic faces of the amphipathic peptides, and they modulate the way these peptides associate with lipidic membranes. Thus, they are an important parameter for understanding peptide&#x2013;membrane interactions, as they emphasize the difference between bonding and permeabilization. Peptides with low polar (or hydrophilic) angles and high hydrophobic means tend to form transmembrane pores. Meanwhile, peptides with equivalent polar and nonpolar faces (amphipathic) tend to bind parallelly to the membrane, with the hydrophobic face interacting with lipids (<xref ref-type="bibr" rid="B36">Dathe and Wieprecht, 1999</xref>). Regardless of the hydrophobicity or the hydrophobic moment, it is expected that the hydrophobic/hydrophilic angle will influence the peptide&#x2019;s insertion in the membrane and the transmembrane pore structures (<xref ref-type="bibr" rid="B128">Uggerh&#xf8;j et al., 2015</xref>).</p>
<p>A study showed that leucine-rich AMPs can insert deeper in the lipid bilayer. Conversely, peptides with lower leucine content were only capable of interacting with the surface of negatively charged membranes. Thus, a broad hydrophobic core is a prerequisite to an effective disturbance of the cellular membrane (<xref ref-type="bibr" rid="B72">Kiyota et al., 1996</xref>).</p>
<p>To study how the polar angle affects AMPs, 3 peptides were modified to have three different polar angles each: 100&#xb0;, 120&#xb0;, and 140&#xb0;. The authors observed that decreased hemolytic activity was present when the peptides had higher polar angles (<xref ref-type="bibr" rid="B126">Tytler et al., 1993</xref>). This effect was also observed for analogs of the scorpion peptide VmCT1, where the increase in the polar angle by the substitution of alanine by glutamic acid residues at the hydrophilic face was important to reduce hemolytic activity by approximately 15 times for the analog [E]<sup>4</sup>-VmCT1-NH<sub>2</sub> (<xref ref-type="bibr" rid="B102">Pedron et al., 2017</xref>).</p>
<p>It was also observed that the balance between the hydrophobic and hydrophilic faces in the analogs of the scorpion peptide Pin2 induced a lower hemolytic activity (<xref ref-type="bibr" rid="B107">Rodr&#xed;guez et al., 2014</xref>), making it evident that alterations in the balance of the polar and nonpolar faces mainly affect the membrane permeabilization efficiency and the reduced amphipathicity can, at least partially, decrease hemolytic activity. Uggerh&#xf8;j and collaborators (2015) concluded that the general activity of an &#x3b1;-helical AMP is modulated by the strength of the interaction of its hydrophilic face with the lipid head groups and the solvent, and by the strength of the interaction of its hydrophobic face with the interior of the membrane.</p>
</sec>
</sec>
<sec id="s3">
<title>General Antimicrobial Peptide Molecular Targets</title>
<p>The main mechanism of action of AMPs is associated with their capacity to cause membrane damage. The interaction between AMPs and microorganisms occurs due to electrostatic forces between their positive amino acid residues and the negative charges exposed at the pathogen surfaces (<xref ref-type="bibr" rid="B2">Almaaytah and Albalas, 2014</xref>). However, most studies neglect the fact that microbial cells have cell walls, component that can be a cellular target or contain molecular targets for AMPs, besides being a defensive physical barrier against antibiotic molecules (<xref ref-type="bibr" rid="B103">Peschel and Sahl, 2006</xref>).</p>
<p>Cell wall is the bacterial structure responsible for the shape of bacterial cells, preventing lysis due to high cytoplasmic osmotic pressure. Moreover, it permits anchoring of membrane components and extracellular proteins. The major component of the Gram-positive bacteria cell wall is the peptidoglycan associated with teichoic (TA) and lipoteichoic acid (LTA), which are responsible for the negative net charge in these bacteria (<xref ref-type="bibr" rid="B110">Scott et al., 1999</xref>). Differently, Gram-negative bacteria present an outer membrane, composed mainly of negatively charged lipopolysaccharides (LPS), overlapping the peptidoglycan. The set of LPS provides a protection barrier against the insertion of molecules with molecular weight higher than 1,000&#xa0;Da. It also provides a defense mechanism against antibiotics and AMPs as larger molecules cannot translocate through the membrane (<xref ref-type="bibr" rid="B73">Kotra et al., 1999</xref>).</p>
<p>It is possible that the cationic and amphiphilic nature of AMPs allows these peptides to accumulate on the negatively charged bacterial surface. In such a way, AMPs can promote cell wall destabilization by interacting with microbial surface components (<xref ref-type="bibr" rid="B18">Brogden, 2005</xref>). This interaction mechanism between AMPs and pathogen cell wall components has already been described for various peptides. For example, Kn2-7, an analog peptide from BmKn2, a native peptide from the scorpion <italic>M. martensii</italic>, promoted the disruption of <italic>Staphylococcus aureus</italic> and <italic>Escherichia coli</italic> cell walls through interaction with LTA and LPS, respectively (<xref ref-type="bibr" rid="B22">Cao et al., 2012</xref>). In another study, it was observed that the analogs of Bac2A generated drastic changes at the surface of <italic>S. aureus</italic> cells, such as protuberances and fissures at the cell wall, but interferences on the cellular membrane were not observed. Bac2A analogs only had effect on the cell wall, inhibiting <italic>S. aureus</italic> without cellular lysis (<xref ref-type="bibr" rid="B139">Wu X. et al., 2014</xref>).</p>
<p>Mainly negatively charged lipids, such as phosphatidylglycerol (PG), cardiolipin, and the zwitterionic phosphatidylethanolamine (PE), compose the bacterial cellular membrane. The interaction and action of these peptides against target cells depend not only on the cell surface but also on the AMP&#x2019;s amino acid composition. This hypothesis is supported by the conserved positive amino acid residues in AMP sequences from several organisms (<xref ref-type="bibr" rid="B61">Guilhelmelli et al., 2013</xref>). Moreover, the peptide&#x2019;s secondary structure is essential for the interaction with anionic phospholipids (<xref ref-type="bibr" rid="B88">Matsuzaki, 2009</xref>). AMPs can induce various membrane defects, and the most characterized are pore formation, phase separation, and lipid bilayer rupture (<xref ref-type="bibr" rid="B112">Seyfi et al., 2020</xref>). Some models have been proposed to explain the membrane rupture caused by AMPs (<xref ref-type="fig" rid="F4">Figure 4</xref>).</p>
<fig id="F4" position="float">
<label>FIGURE 4</label>
<caption>
<p>Schematic models of the main proposed mechanisms of action of AMPs on microorganism cellular membranes.</p>
</caption>
<graphic xlink:href="fmolb-09-887763-g004.tif"/>
</fig>
<p>In the toroidal model, the peptides insert in the membrane forming a beam, inducing the lipids to bend continuously across the pore. As a consequence, membrane lipids become interleaved with the peptides participating in the pore&#x2019;s structure (<xref ref-type="bibr" rid="B142">Yang et al., 2001</xref>; <xref ref-type="bibr" rid="B143">Yeaman and Yount, 2003</xref>). The carpet model is characterized by the overlay of AMPs at the membrane surface, acting as an emulsifier affecting the membrane&#x2019;s structure (<xref ref-type="bibr" rid="B108">Rotem and Mor, 2009</xref>). This interaction is initiated by electrostatic attraction, and then the density of AMPs on the membrane surface increases until a threshold is reached, leading to membrane disintegration, causing cell lysis and micelle formation (<xref ref-type="bibr" rid="B98">Oren and Shai, 1998</xref>; <xref ref-type="bibr" rid="B112">Seyfi et al., 2020</xref>). The Barrel&#x2013;Stave model states that AMP monomers interact with the cell surface, where they oligomerize creating a pore. The recruitment of additional monomers can enlarge the pore, promoting cellular extravasation and cell death. In this mechanism, the peptide&#x2019;s secondary structures, such as &#x3b1;-helix and amphipathic &#x3b2;-sheet, are essential for pore formation (<xref ref-type="bibr" rid="B16">Breukink and de Kruijff, 1999</xref>). Hydrophobic peptide regions interact with the membrane lipids, while the hydrophilic regions interact forming the pore lumen. One of the major differences between the toroidal pore and the Barrel-Stave pore is the participation of phospholipids forming the pore along with AMPs in the former, whereas the latter is formed only by peptides (<xref ref-type="bibr" rid="B18">Brogden, 2005</xref>; <xref ref-type="bibr" rid="B96">Nguyen et al., 2011</xref>).</p>
<p>Furthermore, some AMPs can target intracellular components such as nucleic acid and proteins. It has been reported that AMPs Smp24 and Smp43 from the Egyptian scorpion <italic>Scorpio maurus palmatus</italic> not only disrupt bacterial cell membranes but can also interfere with intracellular gene expression (<xref ref-type="bibr" rid="B120">Tawfik et al., 2021</xref>). A study using radioactive isotopes clearly showed that I9K-IsCT and E7K, which are analogs of IsCT from the scorpion <italic>O. madagascariensis</italic>, inhibit nucleic acids and protein synthesis in <italic>E. coli</italic> (<xref ref-type="bibr" rid="B125">Tripathi et al., 2015</xref>). This strengthens the idea that a single AMP can show multiple mechanisms of action.</p>
<p>Nevertheless, some peptides are too small and cannot lead to pore formation, but instead, they can cause membrane disturbance, such as thinning, and modified electrostatics. These peptides can spread to the cytoplasm and bind to intracellular targets, altering natural events, such as cell wall synthesis and cell division. These molecular interactions occur due to the chemical composition of the molecule, in addition to structural factors such as size and secondary structure (<xref ref-type="bibr" rid="B52">Fjell et al., 2012</xref>) (<xref ref-type="fig" rid="F5">Figure 5</xref>).</p>
<fig id="F5" position="float">
<label>FIGURE 5</label>
<caption>
<p>Illustration of the main molecular targets of AMPs already described. AMP, antimicrobial peptide; TA, teichoic acid; LTA, lipoteichoic acid.</p>
</caption>
<graphic xlink:href="fmolb-09-887763-g005.tif"/>
</fig>
</sec>
<sec id="s4">
<title>Structural Analysis Through Nuclear Magnetic Resonance</title>
<p>Nuclear magnetic resonance spectroscopy is a technique used to study the atomic structure of different molecules. Thus, analyzing AMP structures through NMR spectroscopy can help to infer structures and shed light on their mechanism of action at the atomic level (<xref ref-type="bibr" rid="B97">Nomura et al., 2014</xref>).</p>
<p>Liquid-state NMR spectroscopy is widely used to study the structure of these peptides (<xref ref-type="bibr" rid="B76">Lee et al., 2004</xref>; <xref ref-type="bibr" rid="B55">Gao et al., 2009</xref>; <xref ref-type="bibr" rid="B35">Daniele-Silva et al., 2021</xref>). To that end, solvents such as water, TFE, and SDS can be used to better understand their solubility and flexibility structure in different environments. But solid-state NMR is an approach used to analyze their interaction with membrane mimetics, such as vesicles containing different phospholipids, with phosphatidylcholine or phosphatidylglycerol being the most used. By altering the proportion of these lipids and using solid NMR analysis, it is possible to assess their interaction with different vesicle compositions, and thus, the specificity of these peptides (<xref ref-type="bibr" rid="B10">Bandyopadhyay et al., 2014</xref>; <xref ref-type="bibr" rid="B97">Nomura et al., 2014</xref>).</p>
<p>
<xref ref-type="table" rid="T3">Table 3</xref> shows a series of AMPs from scorpion venoms that have been analyzed by NMR spectroscopy, the equipment information, and solvent used, as well as the overall structure result. It is possible to note from this table that AMPs from scorpions are mostly studied and analyzed using liquid-state NMR spectrometer functioning at 500&#x2013;800&#xa0;MHz, in water or TFE solution or in SDS or DPC micelles. When analyzing the same peptide in different solvents, it is possible to notice changes in the percentage of structure obtained; for example, ctriporin showed 73.6% of &#x3b1;-helix in SDS and 52.6% of &#x3b1;-helix in DPC micelles (<xref ref-type="bibr" rid="B10">Bandyopadhyay et al., 2014</xref>). Therefore, it is important to assess the structure of these peptides in an environment that better mimics membranes to acquire the more accurate structure they show when acting on microbial membranes.</p>
<table-wrap id="T3" position="float">
<label>TABLE 3</label>
<caption>
<p>Comparison of the structure of antimicrobial peptides from scorpion venom analyzed by nuclear magnetic resonance spectroscopy.</p>
</caption>
<table>
<thead valign="top">
<tr>
<th align="left">Peptide/references</th>
<th align="center">Sequence<xref ref-type="table-fn" rid="Tfn4">
<sup>a</sup>
</xref>
</th>
<th align="center">Equipment</th>
<th align="center">Solvent</th>
<th align="center">Structure</th>
</tr>
</thead>
<tbody valign="top">
<tr>
<td align="left">
<bold>Androctonin</bold>/<xref ref-type="bibr" rid="B87">Mandard et al. (1999)</xref>
</td>
<td align="left">RSVCRQIKICRRRGGCYYKCTNRPY</td>
<td align="left">Liquid probe&#x2014;500&#xa0;MHz</td>
<td align="center">H<sub>2</sub>O:D<sub>2</sub>O (9:1)</td>
<td align="left">&#x3b2;-Hairpin</td>
</tr>
<tr>
<td align="left">
<bold>Meucin-13</bold>/<xref ref-type="bibr" rid="B55">Gao et al. (2009)</xref>
</td>
<td align="left">IFGAIAGLLKNIF</td>
<td align="left">Liquid probe&#x2014;600&#xa0;MHz</td>
<td align="center">H<sub>2</sub>O:d<sub>3</sub>-TFE (1:1)</td>
<td align="left">61.5% &#x3b1;-helix</td>
</tr>
<tr>
<td align="left">
<bold>Meucin-18</bold>/<xref ref-type="bibr" rid="B55">Gao et al. (2009)</xref>
</td>
<td align="left">FFGHLFKLATKIIPSLFQ</td>
<td align="left">Liquid probe&#x2014;600&#xa0;MHz</td>
<td align="center">H<sub>2</sub>O:d<sub>3</sub>-TFE (1:1)</td>
<td align="left">76.4% &#x3b1;-helix</td>
</tr>
<tr>
<td align="left">
<bold>Meucin-24</bold>/<xref ref-type="bibr" rid="B56">Gao et al. (2010)</xref>
</td>
<td align="left">GRGREFMSNLKEKLSGVKEKMKNS</td>
<td align="left">Liquid probe&#x2014;600&#xa0;MHz</td>
<td align="center">H<sub>2</sub>O:d<sub>3</sub>-TFE (1:1)</td>
<td align="left">70.8% &#x3b1;-helix</td>
</tr>
<tr>
<td align="left">
<bold>Stigmurin</bold>/<xref ref-type="bibr" rid="B35">Daniele-Silva et al. (2021)</xref>
</td>
<td align="left">FFSLIPSLVGGLISAFK</td>
<td align="left">Liquid probe&#x2014;800&#xa0;MHz</td>
<td align="center">H<sub>2</sub>O:d<sub>3</sub>-TFE (3:2)</td>
<td align="left">58.8% &#x3b1;-helix</td>
</tr>
<tr>
<td align="left">
<bold>IsCT</bold>/<xref ref-type="bibr" rid="B76">Lee et al. (2004)</xref>
</td>
<td align="left">ILGKIWEGIKSLF</td>
<td align="left">Liquid probe&#x2014;600&#xa0;MHz</td>
<td align="center">D<sub>25</sub>-SDS</td>
<td align="left">46.1% &#x3b1;-helix</td>
</tr>
<tr>
<td align="left">
<bold>[A</bold>
<sup>
<bold>6</bold>
</sup>
<bold>]-IsCT</bold>/<xref ref-type="bibr" rid="B76">Lee et al. (2004)</xref>
</td>
<td align="left">ILGK<bold>
<underline>A</underline>
</bold>WEGIKSLF</td>
<td align="left">Liquid probe&#x2014;600&#xa0;MHz</td>
<td align="center">D<sub>25</sub>-SDS</td>
<td align="left">Random structure</td>
</tr>
<tr>
<td align="left">
<bold>[K</bold>
<sup>
<bold>7</bold>
</sup>
<bold>]-IsCT</bold>/<xref ref-type="bibr" rid="B76">Lee et al. (2004)</xref>
</td>
<td align="left">ILGKIW<bold>
<underline>K</underline>
</bold>GIKSLF</td>
<td align="left">Liquid probe&#x2014;600&#xa0;MHz</td>
<td align="center">D<sub>25</sub>-SDS</td>
<td align="left">84.6% &#x3b1;-helix</td>
</tr>
<tr>
<td align="left">
<bold>[K</bold>
<sup>
<bold>7</bold>
</sup>
<bold>, P</bold>
<sup>
<bold>8</bold>
</sup>
<bold>, K</bold>
<sup>
<bold>11</bold>
</sup>
<bold>]-IsCT</bold>/<xref ref-type="bibr" rid="B76">Lee et al. (2004)</xref>
</td>
<td align="left">ILGKIW<bold>
<underline>K</underline>
</bold>IK<bold>
<underline>K</underline>
</bold>LF</td>
<td align="left">Liquid probe&#x2014;600&#xa0;MHz</td>
<td align="center">D<sub>25</sub>-SDS</td>
<td align="left">46.1% &#x3b1;-helix</td>
</tr>
<tr>
<td align="left">
<bold>Pandinin 2</bold>/<xref ref-type="bibr" rid="B31">Corzo et al. (2001)</xref>
</td>
<td align="left">FWGALAKGALKLIPSLFSSFSKKD</td>
<td align="left">Liquid probe&#x2014;500 and 600&#xa0;MHz</td>
<td align="center">DPC micelles</td>
<td align="left">79.1% &#x3b1;-helix</td>
</tr>
<tr>
<td align="left">
<bold>Ctriporin</bold>/<xref ref-type="bibr" rid="B10">Bandyopadhyay et al. (2014)</xref>
</td>
<td align="left">FLWGLIPGAISAVTSLIKK</td>
<td align="left">Liquid probe&#x2014;800&#xa0;MHz</td>
<td align="center">SDS</td>
<td align="left">73.6 &#x3b1;-helix</td>
</tr>
<tr>
<td align="left">
<bold>Ctriporin</bold>/<xref ref-type="bibr" rid="B10">Bandyopadhyay et al. (2014)</xref>
</td>
<td align="left">FLWGLIPGAISAVTSLIKK</td>
<td align="left">Cryoprobe&#x2014;800&#xa0;MHz</td>
<td align="center">DPC micelles</td>
<td align="left">52.6 &#x3b1;-helix</td>
</tr>
<tr>
<td align="left">
<bold>Pin1</bold>/<xref ref-type="bibr" rid="B97">Nomura et al. (2014)</xref>
</td>
<td align="left">GKVWDWIKSAAKKIWSSEPVSQLKGQVLNAAKNYVAEKIGATPT</td>
<td align="left">Solid probe&#x2014;300&#xa0;MHZ</td>
<td align="center">PC or PC/PG vesicles</td>
<td align="left">2 &#x3b1;-helix separated by 8 aa in random structure</td>
</tr>
</tbody>
</table>
<table-wrap-foot>
<fn id="Tfn4">
<label>a</label>
<p>Modifications in analog peptides are marked in bold.</p>
</fn>
</table-wrap-foot>
</table-wrap>
<p>Exploring the structure of AMPs using the NMR technique can also improve the rational design of new molecules, as it makes it possible to observe the amino acid residues important to the structure assembly and the antimicrobial activity. When Lee and collaborators (2004) studied the peptide IsCT and its analogs, they observed that the substitution of tryptophan by alanine at position 6 of the sequence resulted in a change from an &#x3b1;-helix to an unstructured peptide and a dramatic decrease in the antimicrobial activity, highlighting the importance of this residue for the structure-activity of this peptide. On the other hand, another analog of the IsCT peptide in which glutamic acid was substituted by lysine showed a longer &#x3b1;-helix and higher antimicrobial activity, proving it to be a satisfactory modification.</p>
<p>Solid-state NMR is a technique that can provide results for a better understanding of the mechanism of action of AMPs. The interaction of Pin1 with vesicles containing phosphatidylcholine (PC) was analyzed, and the results demonstrated the formation of a cubic phase. The cationic portion of a choline headgroup from the vesicles binds with the aromatic sidechain of the tryptophan, whereas when studying an analog in which tryptophan was substituted by an alanine residue, the cubic phase was not observed, indicating the importance of tryptophan for the Pin1 mechanism of action (<xref ref-type="bibr" rid="B97">Nomura et al., 2014</xref>). Through the solid-state NMR analysis of this peptide, Nomura and collaborators (2014) were also able to evaluate the specificity of Pin1 by analyzing its interaction with vesicles containing only phosphatidylcholine and containing both phosphatidylcholine and phosphatidylglycerol; in the latter, Pin1 did not induce the cubic phase, showing interaction with only PC vesicles as it did in vesicles containing only PC. These studies convey the significance of NMR spectroscopy studies of AMPs as an analytical tool to assess their structure and mechanism of action.</p>
</sec>
<sec id="s5">
<title>Amino Acid Substitutions and Their Effect on Antimicrobial and Hemolytic Activities</title>
<sec id="s5-1">
<title>Amino Acid Classification Based on Side Chain (R) Polarity</title>
<p>Amino acids can be classified based on the polarity of their side chain. According to that, amino acids can be nonpolar (hydrophobic or insoluble in water), neutral polar (hydrophilic or soluble in water), negatively charged (acidic), and positively charged polar (basic) (<xref ref-type="bibr" rid="B77">Lee et al., 2011</xref>). Polarity is the capacity of a chemical group to form electrical poles, which enables solubilization in water by interacting with water molecules by the formation of hydrogen bonds. Nonpolar amino acids are insoluble in water due to their hydrocarbon organic chains, which are unable to form hydrogen bonds with water molecules. Polar amino acids are soluble in water because of their polar side groups, such as OH, NH, and C &#x3d; O. Basic amino acids present a positive net charge at pH 7.0, while acidic amino acids show a negative net charge at pH 7.0. This information allows several rational substitutions in the peptide&#x2019;s primary structure according to the properties one aims to change (<xref ref-type="bibr" rid="B11">Barth, 2000</xref>; <xref ref-type="bibr" rid="B92">Moreira et al., 2007</xref>). Modifications for scorpion peptides are listed in <xref ref-type="table" rid="T1">Table 1</xref>.</p>
</sec>
<sec id="s5-2">
<title>Basic Amino Acid Residue Modification</title>
<p>Replacement of amino acids by basic amino acid residues in AMPs, such as lysine and arginine, confers a higher positive charge, as they are positively net charged in neutral pH. The positive side chains of amino acids are externally oriented on &#x3b1;-helical peptides, as they make up the helice&#x2019;s hydrophilic face (<xref ref-type="bibr" rid="B63">Hancock, 1997</xref>; <xref ref-type="bibr" rid="B6">Amorim-Carmo et al., 2019</xref>).</p>
<p>Numerous approaches have been performed to evaluate the positive charge influence on antimicrobial activity (<xref ref-type="table" rid="T1">Table 1</xref>), and it is observed that increased antimicrobial activity correlates with increased cationicity (<xref ref-type="table" rid="T2">Table 2</xref>). The cationicity increase is usually associated with higher antibacterial activity (<xref ref-type="bibr" rid="B38">la Salud Bea et al., 2015</xref>).</p>
<p>Stigmurin, a peptide from the scorpion <italic>T. stigmurus</italic>, was modified by substituting serine and glycine to lysine residues. These replacements resulted in an increase in the net charge from &#x2b;2 to &#x2b;7, and also higher antimicrobial activity and broadened activity spectrum (<xref ref-type="bibr" rid="B101">Parente et al., 2018</xref>; <xref ref-type="bibr" rid="B6">Amorim-Carmo et al., 2019</xref>). Stigmurin did not show activity against Gram-negative bacteria, but it was observed that with the increased positive charge generated by lysine substitution, its analogs demonstrated potent antimicrobial activity against several Gram-negative strains with an MIC of 2.4&#xa0;&#xb5;M (<xref ref-type="bibr" rid="B101">Parente et al., 2018</xref>).</p>
<p>A similar replacement was performed in the AMP from the scorpion <italic>Androctonus amoreuxi</italic> venom denominated AamAP1. By replacing histidine with lysine in the native peptide AamAP1, the analog named AamAP-S1 was produced. This substitution resulted in a higher net charge, while other structural parameters related to its activity were not altered. AamAP-S1 showed a remarkable increase in antimicrobial activity and activity spectrum. To illustrate that, the sensibility of <italic>E. coli</italic> to AamAP-S1 was 25-fold higher than to AamAP1. A similar increase in activity was observed when the analog was tested against the Gram-positive bacteria <italic>S. aureus</italic> and the yeast <italic>Candida albicans</italic> (<xref ref-type="bibr" rid="B5">Almaaytah et al., 2012</xref>).</p>
<p>To analyze how changes in net charge affect antimicrobial activity, analogs of the peptide VmCT1 from the scorpion <italic>Vaejovis mexicanus smithi</italic> were generated by substituting glycine, asparagine, and serine with lysine at the hydrophilic face. These analogs also had higher antimicrobial activity when compared with the native peptide. Substitution of asparagine by lysine in the [K]<sup>7</sup>-VmCT1-NH<sub>2</sub> analog showed an MIC value between 0.39 and 12.5&#xa0;&#xb5;M against <italic>B. subtilis</italic> and <italic>C. albicans</italic>; this represents an 8-fold increase when compared to the native peptide VmCT1. These substitutions reassert that cationicity is one of the most important physicochemical parameters related to strong interactions between AMPs and microorganisms, which is crucial to the antimicrobial activity (<xref ref-type="bibr" rid="B102">Pedron et al., 2017</xref>).</p>
</sec>
<sec id="s5-3">
<title>Hydrophobic Residue Modifications</title>
<p>The R group of nonpolar amino acids is hydrophobic. It is known that peptides have a polycationic and hydrophobic nature and that these properties are important to the initial interaction between AMPs and bacterial cell membrane (<xref ref-type="bibr" rid="B64">Hancock et al., 1995</xref>; <xref ref-type="bibr" rid="B135">Wu et al., 1999</xref>; <xref ref-type="bibr" rid="B8">Andrade and Colherinhas, 2020</xref>).</p>
<p>The amino acid leucine can enhance hydrophobicity in an amphipathic structure (i.e., &#x3b1;-helices), playing an important role in antimicrobial activity through the interaction with bacterial membranes (<xref ref-type="bibr" rid="B71">Kim et al., 2018</xref>). Based on the nature of the AMP, it is expected that by increasing the hydrophobicity of the peptide, the helicity will increase, resulting in greater antimicrobial activity; however, increased hemolytic activity can also be observed (<xref ref-type="bibr" rid="B143">Yeaman and Yount, 2003</xref>; <xref ref-type="bibr" rid="B101">Parente et al., 2018</xref>; <xref ref-type="bibr" rid="B6">Amorim-Carmo et al., 2019</xref>).</p>
<p>A study evaluated the influence of the hydrophobicity enhancement on scorpion AMPs, and it was observed that, in general, higher hydrophobicity corresponds to the increase in antimicrobial and hemolytic activities (<xref ref-type="bibr" rid="B12">de la Salud Bea et al., 2015</xref>). Another study observed that the substitution of hydrophobic amino acids to the AMP BmKn2 results in an increased helicity and higher antimicrobial activity. These improvements in activity were attributed to higher hydrophobicity in the analogs (<xref ref-type="bibr" rid="B39">de la Salud Bea et al., 2017</xref>).</p>
<p>Increased antimicrobial activity was also observed for the analog from IsCTL1 from <italic>O. madagascariensis</italic> with leucine substitutions. These analogs inhibited <italic>S. aureus</italic> growth at concentrations around 20&#x2013;25&#xa0;&#x3bc;g/ml, while <italic>E. coli</italic> inhibition occurred at concentrations of 15&#x2013;25&#xa0;&#xb5;g/ml. On the other hand, the analog with valine substitutions inhibited bacterial growth at concentrations lower than 10&#xa0;&#xb5;g/ml (<xref ref-type="bibr" rid="B39">de la Salud Bea et al., 2017</xref>). In general, the results showed that increased hydrophobicity, as a result of alanine, valine, and leucine substitutions, enhanced antibacterial activity. However, it also incremented the peptide&#x2019;s hemolytic activity (<xref ref-type="bibr" rid="B39">de la Salud Bea et al., 2017</xref>).</p>
</sec>
<sec id="s5-4">
<title>Polar (Uncharged) Residue Modifications</title>
<p>Polar uncharged residue R groups are soluble in water because of their functional groups that bind to water molecules. The main amino acids classified as polar are serine, threonine, cysteine, asparagine, and glutamine. Glycine has the simplest structure, and although it is easily classified as a nonpolar amino acid, its side chain is too small, so it does not really contribute to hydrophobic interactions (<xref ref-type="bibr" rid="B94">Nelson et al., 2008</xref>). Frequently, uncharged amino acids are substituted by basic or hydrophobic residues when one intends to increase charge and hydrophobicity, respectively. For scorpion analog peptides, this type of substitution is usually observed (<xref ref-type="table" rid="T1">Table 1</xref>). Substitution of neutral residues (serine and asparagine for lysine) on the hydrophilic face resulted in more effective MIC values when compared to the native peptide: the analog [K]<sup>7</sup>-VmCT1-NH<sub>2</sub> presented an MIC value varying from 0.39 to 12.5&#xa0;&#xb5;M, and [K]<sup>11</sup>-VmCT1-NH<sub>2</sub> showed an MIC between 0.39 and 6.25&#xa0;&#xb5;M. But the most significant antimicrobial activity was obtained against <italic>P. aeruginosa</italic> (0.78, 0.39, and 0.39&#xa0;&#xb5;M, respectively) (<xref ref-type="bibr" rid="B102">Pedron et al., 2017</xref>).</p>
<p>By substituting serine residues for cationic residues, Du and contributors (2014) observed enhanced antifungal activity (MICs from 16 to 4&#xa0;&#xb5;M) for the analog peptides of AcrAP1 and AcrAP2 from the scorpion <italic>Androctonus crassicauda</italic>. The authors tested the activity against Gram-positive bacteria and yeasts and observed increased activity spectrum for Gram-negative bacteria (MIC 8&#xa0;&#xb5;M), as the opposite of the native peptides, which did not show activity against Gram-negative strains. Enhanced activity spectrum was also demonstrated by Parente and contributors (2018) using Stigmurin as the prototype, a higher activity spectrum for Gram-negative bacteria was achieved by the substituting neutral for basic residues.</p>
<p>A study evaluated the influence of glycine at the Pandinin 2 (Pin2) sequence, which is a highly hemolytic peptide with a central proline residue. This amino acid forms a kink at the center of the structure that is related to its pore-forming activity in human erythrocytes (<xref ref-type="bibr" rid="B107">Rodr&#xed;guez et al., 2014</xref>). To decrease hemolytic activity, the authors replaced the Pro14 residues in Pin2 with glycine residues and the structural motif with Pro14 between two Gly residues (P14G and P14GPG). AMPs with structural motifs containing glycine (Gly and GlyProGly), such as magainin 2 and ponericin G1, are observed to exert low hemolytic activity (<xref ref-type="bibr" rid="B107">Rodr&#xed;guez et al., 2014</xref>). It was observed that proline to glycine substitution at the Pin2 [G] analog did not lead to the reduction of the hemolytic activity; however, the Pin2 [GPG] analog showed 5-fold reduction in hemolysis when compared with the native peptide Pin2 (<xref ref-type="bibr" rid="B107">Rodr&#xed;guez et al., 2014</xref>). This demonstrates that the residue triad GlyProGly might have a fundamental role in hemolytic activity and can be altered to reduce it.</p>
</sec>
<sec id="s5-5">
<title>Acidic Residue Modifications</title>
<p>Amino acids with a negatively charged R group at pH 7.0 include aspartic acid and glutamic acid, and generally are substituted by hydrophobic positively charged residues, due to the important role that these features play in the antimicrobial activity. La Salud Bea and collaborates (2017) studied the effect of lysine substitution by glutamic acid in the native peptide IsCT1 from the scorpion <italic>O. madagascariensis</italic>. The analog IsCT1E7, which presented a negative net charge of -1, did not show significant bacterial growth inhibition or apparent cytotoxicity at the conditions and concentrations tested. Controversially, substituting glutamic acid by lysine in Hp1404 from the scorpion <italic>Heterometrus petersii</italic> resulted in the analog named Hp1404-T1c, which showed 4-fold improvement in antimicrobial activity against <italic>Pseudomonas aeruginosa</italic> when compared with the native peptide (<xref ref-type="bibr" rid="B71">Kim et al., 2018</xref>). These achievements strengthen the hypothesis that positive charge has a considerable influence on these peptides&#x2019; mechanism of action.</p>
</sec>
<sec id="s5-6">
<title>Hemolytic Activity</title>
<p>Although many AMPs show activity towards prokaryotic membranes, they may also interact and disturb eukaryotic membranes. The lack of specificity toward mammalian membranes is attributed not only to the lack of negatively charged lipids but also to the absence of a strong negative membrane potential in most mammalian membranes (<xref ref-type="bibr" rid="B89">Maturana et al., 2017</xref>). However, AMPs are able to interact with the erythrocyte surface by binding to sialic acid present in glycocalyx, glycoproteins, or glycosphingolipids (<xref ref-type="bibr" rid="B65">Hancock and Sahl, 2006</xref>). Increased hemolytic activity in most AMP analogs is commonly observed, and it can be associated with a higher net charge (<xref ref-type="bibr" rid="B140">Xie et al., 2017</xref>). La Salud Bea and contributors (2015) studied analogs from the native peptide BmKn1 from the scorpion <italic>B. martensii</italic> and argued that when modifications are made to enhance the positive net charge with lysine replacement, both antimicrobial and hemolytic activities increase.</p>
<p>The hemolytic activities of analogs from TsAP-1 and TsAP-2 were considerably affected by the enhanced net charge. By substituting four neutral amino acid residues by lysine, antimicrobial and hemolytic activities were dramatically affected (<xref ref-type="table" rid="T2">Table 2</xref>) (<xref ref-type="bibr" rid="B62">Guo et al., 2013</xref>). Therefore, it is evident that cytotoxicity against mammalian cells is a limiting factor for the therapeutic application of AMPs, but it is also clear that changes in sequence can overcome this challenge.</p>
<p>It is also worth pointing out that effective perturbation of the erythrocyte membranes is more dependent on high permeabilization efficiency than high lipidic affinity (<xref ref-type="bibr" rid="B107">Rodr&#xed;guez et al., 2014</xref>; <xref ref-type="bibr" rid="B89">Maturana et al., 2017</xref>). Because hemolytic activity can be effectively reduced by decreasing amphipathicity (helix disturbance and reduced hydrophobic moment) and by decreasing the hydrophobic domain, these features are a powerful foundation to modulate AMP selectivity toward microbes (<xref ref-type="bibr" rid="B107">Rodr&#xed;guez et al., 2014</xref>).</p>
<p>On the other hand, a study that did not modify peptides by increasing the charge but by replacing L-amino acids by D-amino acids with Pin2 used a D-diastereomer (D-Pin2) to assess whether it maintained the same antimicrobial activity as L-Pin2, and to reduce its hemolytic activity for human erythrocytes. Although the hydrophobic and secondary structure characteristics of L- and D-Pin2 were relatively similar, an important reduction in D-Pin2 hemolytic activity (30&#x2013;40%) was achieved compared with that of L-Pin2. Moreover, the antimicrobial activity of D-Pin2 was reduced by half compared to that of L-Pin2 (<xref ref-type="bibr" rid="B23">Carmona et al., 2013</xref>).</p>
<p>In contrast to the observed hemolytic effects caused by increased net charge, Kim and contributors (2018) designed analogs of the scorpion peptide Hp1404. The analogs were generated through the substitution of neutral residues by lysine, which enhanced the net charge from &#x2b;1 to &#x2b;6. The modified AMPs showed lower hemolytic activity and lower cell toxicity than the native peptide, especially the analog Hp1404-T1e, which had a net charge of &#x2b;6 and exhibited potent antimicrobial and antibiofilm activity against multiresistant <italic>Pseudomonas aeruginosa</italic> (MRPA) strains, and it was also functional in physiologic conditions. Modifications in Hp1404 demonstrate the potential use of the AMPs as efficient therapeutic agents and reinforce the possibility of designing safer peptides. Moreover, these results suggest that not only the net charge but also the primary structure and, consequently, the secondary conformation contributed to the hemolytic activity (<xref ref-type="bibr" rid="B71">Kim et al., 2018</xref>). Furthermore, <italic>in vitro</italic> assays provide an excellent starting point, but the antimicrobial field urgently needs <italic>in vivo</italic> studies to assess the toxicity and stability associated with the potential use of these peptides in therapy.</p>
</sec>
</sec>
</body>
<back>
<sec id="s6">
<title>Author Contributions</title>
<p>BA-C and AP planned and wrote the manuscript. ES, AS-J, RA, and MF-P wrote and corrected the manuscript.</p>
</sec>
<sec id="s7">
<title>Funding</title>
<p>The research reported in this article was supported by the Conselho Nacional de Desenvolvimento Cient&#xed;fico e Tecnol&#xf3;gico-CNPq/Brazil, number 442006/2018-7. MF-P and AS-J are researchers at the CNPq.</p>
</sec>
<sec sec-type="COI-statement" id="s8">
<title>Conflict of Interest</title>
<p>The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.</p>
</sec>
<sec sec-type="disclaimer" id="s9">
<title>Publisher&#x2019;s Note</title>
<p>All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors, and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.</p>
</sec>
<ack>
<p>The authors also thank Glenn Hawes, M Ed. (Master of English Education, University of Georgia), for editing the manuscript.</p>
</ack>
<ref-list>
<title>References</title>
<ref id="B1">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Ahmadi</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Knerr</surname>
<given-names>J. M.</given-names>
</name>
<name>
<surname>Argemi</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Bordon</surname>
<given-names>K. C. F.</given-names>
</name>
<name>
<surname>Pucca</surname>
<given-names>M. B.</given-names>
</name>
<name>
<surname>Cerni</surname>
<given-names>F. A.</given-names>
</name>
<etal/>
</person-group> (<year>2020</year>). <article-title>Scorpion Venom: Detriments and Benefits</article-title>. <source>Biomedicines</source> <volume>8</volume> (<issue>5</issue>), <fpage>118</fpage>. <pub-id pub-id-type="doi">10.3390/biomedicines8050118</pub-id> </citation>
</ref>
<ref id="B2">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Almaaytah</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Albalas</surname>
<given-names>Q.</given-names>
</name>
</person-group> (<year>2014</year>). <article-title>Scorpion Venom Peptides with No Disulfide Bridges: a Review</article-title>. <source>Peptides</source> <volume>51</volume>, <fpage>35</fpage>&#x2013;<lpage>45</lpage>. <pub-id pub-id-type="doi">10.1016/j.peptides.2013.10.021</pub-id> </citation>
</ref>
<ref id="B3">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Almaaytah</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Farajallah</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Abualhaijaa</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Al-Balas</surname>
<given-names>Q.</given-names>
</name>
</person-group> (<year>2018</year>). <article-title>A3, a Scorpion Venom Derived Peptide Analogue with Potent Antimicrobial and Potential Antibiofilm Activity against Clinical Isolates of Multi-Drug Resistant Gram Positive Bacteria</article-title>. <source>Molecules</source> <volume>23</volume> (<issue>7</issue>), <fpage>1603</fpage>. <pub-id pub-id-type="doi">10.3390/molecules23071603</pub-id> </citation>
</ref>
<ref id="B4">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Almaaytah</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Tarazi</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Abu-Alhaijaa</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Altall</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Alshar&#x27;i</surname>
<given-names>N.</given-names>
</name>
<name>
<surname>Bodoor</surname>
<given-names>K.</given-names>
</name>
<etal/>
</person-group> (<year>2014</year>). <article-title>Enhanced Antimicrobial Activity of AamAP1-Lysine, a Novel Synthetic Peptide Analog Derived from the Scorpion Venom Peptide AamAP1</article-title>. <source>Pharmaceuticals</source> <volume>7</volume> (<issue>5</issue>), <fpage>502</fpage>&#x2013;<lpage>516</lpage>. <pub-id pub-id-type="doi">10.3390/ph7050502</pub-id> </citation>
</ref>
<ref id="B5">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Almaaytah</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Zhou</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Wang</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Chen</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>Walker</surname>
<given-names>B.</given-names>
</name>
<name>
<surname>Shaw</surname>
<given-names>C.</given-names>
</name>
</person-group> (<year>2012</year>). <article-title>Antimicrobial/cytolytic Peptides from the Venom of the North African Scorpion, Androctonus Amoreuxi: Biochemical and Functional Characterization of Natural Peptides and a Single Site-Substituted Analog</article-title>. <source>Peptides</source> <volume>35</volume> (<issue>2</issue>), <fpage>291</fpage>&#x2013;<lpage>299</lpage>. <pub-id pub-id-type="doi">10.1016/j.peptides.2012.03.016</pub-id> </citation>
</ref>
<ref id="B6">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Amorim-Carmo</surname>
<given-names>B.</given-names>
</name>
<name>
<surname>Daniele-Silva</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Parente</surname>
<given-names>A. M. S.</given-names>
</name>
<name>
<surname>Furtado</surname>
<given-names>A. A.</given-names>
</name>
<name>
<surname>Carvalho</surname>
<given-names>E.</given-names>
</name>
<name>
<surname>Oliveira</surname>
<given-names>J. W. F.</given-names>
</name>
<etal/>
</person-group> (<year>2019</year>). <article-title>Potent and Broad-Spectrum Antimicrobial Activity of Analogs from the Scorpion Peptide Stigmurin</article-title>. <source>Ijms</source> <volume>20</volume> (<issue>3</issue>), <fpage>623</fpage>. <pub-id pub-id-type="doi">10.3390/ijms20030623</pub-id> </citation>
</ref>
<ref id="B7">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Andersson</surname>
<given-names>D. I.</given-names>
</name>
<name>
<surname>Hughes</surname>
<given-names>D.</given-names>
</name>
<name>
<surname>Kubicek-Sutherland</surname>
<given-names>J. Z.</given-names>
</name>
</person-group> (<year>2016</year>). <article-title>Mechanisms and Consequences of Bacterial Resistance to Antimicrobial Peptides</article-title>. <source>Drug Resist. Updat.</source> <volume>26</volume>, <fpage>43</fpage>&#x2013;<lpage>57</lpage>. <pub-id pub-id-type="doi">10.1016/j.drup.2016.04.002</pub-id> </citation>
</ref>
<ref id="B8">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Andrade</surname>
<given-names>D.</given-names>
</name>
<name>
<surname>Colherinhas</surname>
<given-names>G.</given-names>
</name>
</person-group> (<year>2020</year>). <article-title>The Influence of Polar and Non-polar Interactions on the Self-Assembly of Peptide Nanomembranes and Their Applications: An Atomistic Study Using Classical Molecular Dynamics</article-title>. <source>J. Mol. Liq.</source> <volume>318</volume>, <fpage>114263</fpage>. <pub-id pub-id-type="doi">10.1016/j.molliq.2020.114263</pub-id> </citation>
</ref>
<ref id="B9">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Bahar</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Ren</surname>
<given-names>D.</given-names>
</name>
</person-group> (<year>2013</year>). <article-title>Antimicrobial Peptides</article-title>. <source>Pharmaceuticals</source> <volume>6</volume> (<issue>12</issue>), <fpage>1543</fpage>&#x2013;<lpage>1575</lpage>. <pub-id pub-id-type="doi">10.3390/ph6121543</pub-id> </citation>
</ref>
<ref id="B10">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Bandyopadhyay</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Junjie</surname>
<given-names>R. L.</given-names>
</name>
<name>
<surname>Lim</surname>
<given-names>B.</given-names>
</name>
<name>
<surname>Sanjeev</surname>
<given-names>R.</given-names>
</name>
<name>
<surname>Xin</surname>
<given-names>W. Y.</given-names>
</name>
<name>
<surname>Yee</surname>
<given-names>C. K.</given-names>
</name>
<etal/>
</person-group> (<year>2014</year>). <article-title>Solution Structures and Model Membrane Interactions of Ctriporin, an Anti-methicillin-resistantStaphylococcus aureusPeptide from Scorpion Venom</article-title>. <source>Biopolymers</source> <volume>101</volume> (<issue>12</issue>), <fpage>1143</fpage>&#x2013;<lpage>1153</lpage>. <pub-id pub-id-type="doi">10.1002/bip.22519</pub-id> </citation>
</ref>
<ref id="B11">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Barth</surname>
<given-names>A.</given-names>
</name>
</person-group> (<year>2000</year>). <article-title>The Infrared Absorption of Amino Acid Side Chains</article-title>. <source>Prog. Biophys. Mol. Biol.</source> <volume>74</volume> (<issue>3-5</issue>), <fpage>141</fpage>&#x2013;<lpage>173</lpage>. <pub-id pub-id-type="doi">10.1016/s0079-6107(00)00021-3</pub-id> </citation>
</ref>
<ref id="B12">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Bea</surname>
<given-names>R. d. l. S.</given-names>
</name>
<name>
<surname>Petraglia</surname>
<given-names>A. F.</given-names>
</name>
<name>
<surname>Johnson</surname>
<given-names>L. E. L. d.</given-names>
</name>
</person-group> (<year>2015</year>). <article-title>Synthesis, Antimicrobial Activity and Toxicity of Analogs of the Scorpion Venom BmKn Peptides</article-title>. <source>Toxicon</source> <volume>101</volume>, <fpage>79</fpage>&#x2013;<lpage>84</lpage>. <pub-id pub-id-type="doi">10.1016/j.toxicon.2015.05.006</pub-id> </citation>
</ref>
<ref id="B13">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Benarroch</surname>
<given-names>J. M.</given-names>
</name>
<name>
<surname>Asally</surname>
<given-names>M.</given-names>
</name>
</person-group> (<year>2020</year>). <article-title>The Microbiologist&#x27;s Guide to Membrane Potential Dynamics</article-title>. <source>Trends Microbiol.</source> <volume>28</volume> (<issue>4</issue>), <fpage>304</fpage>&#x2013;<lpage>314</lpage>. <pub-id pub-id-type="doi">10.1016/j.tim.2019.12.008</pub-id> </citation>
</ref>
<ref id="B14">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Blazyk</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Wiegand</surname>
<given-names>R.</given-names>
</name>
<name>
<surname>Klein</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Hammer</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Epand</surname>
<given-names>R. M.</given-names>
</name>
<name>
<surname>Epand</surname>
<given-names>R. F.</given-names>
</name>
<etal/>
</person-group> (<year>2001</year>). <article-title>A Novel Linear Amphipathic &#x3b2;-Sheet Cationic Antimicrobial Peptide with Enhanced Selectivity for Bacterial Lipids</article-title>. <source>J. Biol. Chem.</source> <volume>276</volume> (<issue>30</issue>), <fpage>27899</fpage>&#x2013;<lpage>27906</lpage>. <pub-id pub-id-type="doi">10.1074/jbc.m102865200</pub-id> </citation>
</ref>
<ref id="B15">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Brady</surname>
<given-names>D.</given-names>
</name>
<name>
<surname>Grapputo</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Romoli</surname>
<given-names>O.</given-names>
</name>
<name>
<surname>Sandrelli</surname>
<given-names>F.</given-names>
</name>
</person-group> (<year>2019</year>). <article-title>Insect Cecropins, Antimicrobial Peptides with Potential Therapeutic Applications</article-title>. <source>Ijms</source> <volume>20</volume> (<issue>23</issue>), <fpage>5862</fpage>. <pub-id pub-id-type="doi">10.3390/ijms20235862</pub-id> </citation>
</ref>
<ref id="B16">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Breukink</surname>
<given-names>E.</given-names>
</name>
<name>
<surname>de Kruijff</surname>
<given-names>B.</given-names>
</name>
</person-group> (<year>1999</year>). <article-title>The Lantibiotic Nisin, a Special Case or Not?</article-title> <source>Biochim. Biophys. Acta</source> <volume>1462</volume> (<issue>1</issue>), <fpage>223</fpage>&#x2013;<lpage>234</lpage>. <pub-id pub-id-type="doi">10.1016/s0005-2736(99)00208-4</pub-id> </citation>
</ref>
<ref id="B17">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Brinckerhoff</surname>
<given-names>L. H.</given-names>
</name>
<name>
<surname>Kalashnikov</surname>
<given-names>V. V.</given-names>
</name>
<name>
<surname>Thompson</surname>
<given-names>L. W.</given-names>
</name>
<name>
<surname>Yamshchikov</surname>
<given-names>G. V.</given-names>
</name>
<name>
<surname>Pierce</surname>
<given-names>R. A.</given-names>
</name>
<name>
<surname>Galavotti</surname>
<given-names>H. S.</given-names>
</name>
<etal/>
</person-group> (<year>1999</year>). <article-title>Terminal Modifications Inhibit Proteolytic Degradation of an Immunogenic Mart-127-35 Peptide: Implications for Peptide Vaccines</article-title>. <source>Int. J. Cancer</source> <volume>83</volume> (<issue>3</issue>), <fpage>326</fpage>&#x2013;<lpage>334</lpage>. <pub-id pub-id-type="doi">10.1002/(sici)1097-0215(19991029)83:3&#x3c;326::aid-ijc7&#x3e;3.0.co;2-x</pub-id> </citation>
</ref>
<ref id="B18">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Brogden</surname>
<given-names>K. A.</given-names>
</name>
</person-group> (<year>2005</year>). <article-title>Antimicrobial Peptides: Pore Formers or Metabolic Inhibitors in Bacteria?</article-title> <source>Nat. Rev. Microbiol.</source> <volume>3</volume> (<issue>3</issue>), <fpage>238</fpage>&#x2013;<lpage>250</lpage>. <pub-id pub-id-type="doi">10.1038/nrmicro1098</pub-id> </citation>
</ref>
<ref id="B19">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Brogden</surname>
<given-names>N. K.</given-names>
</name>
<name>
<surname>Brogden</surname>
<given-names>K. A.</given-names>
</name>
</person-group> (<year>2011</year>). <article-title>Will New Generations of Modified Antimicrobial Peptides Improve Their Potential as Pharmaceuticals?</article-title> <source>Int. J. Antimicrob. Agents</source> <volume>38</volume> (<issue>3</issue>), <fpage>217</fpage>&#x2013;<lpage>225</lpage>. <pub-id pub-id-type="doi">10.1016/j.ijantimicag.2011.05.004</pub-id> </citation>
</ref>
<ref id="B20">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Brul</surname>
<given-names>S.</given-names>
</name>
</person-group> (<year>2018</year>). <article-title>Cationic Amphipathic Antimicrobial Peptides Perturb the Inner Membrane of Germinated Spores Thus Inhibiting Their Outgrowth</article-title>. <source>Front. Microbiol.</source> <volume>9</volume>, <fpage>2277</fpage>. </citation>
</ref>
<ref id="B21">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Buonocore</surname>
<given-names>F.</given-names>
</name>
<name>
<surname>Fausto</surname>
<given-names>A. M.</given-names>
</name>
<name>
<surname>Della Pelle</surname>
<given-names>G.</given-names>
</name>
<name>
<surname>Roncevic</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>Gerdol</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Picchietti</surname>
<given-names>S.</given-names>
</name>
</person-group> (<year>2021</year>). <article-title>Attacins: A Promising Class of Insect Antimicrobial Peptides</article-title>. <source>Antibiotics</source> <volume>10</volume> (<issue>2</issue>), <fpage>212</fpage>. <pub-id pub-id-type="doi">10.3390/antibiotics10020212</pub-id> </citation>
</ref>
<ref id="B22">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Cao</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Dai</surname>
<given-names>C.</given-names>
</name>
<name>
<surname>Li</surname>
<given-names>Z.</given-names>
</name>
<name>
<surname>Fan</surname>
<given-names>Z.</given-names>
</name>
<name>
<surname>Song</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Wu</surname>
<given-names>Y.</given-names>
</name>
<etal/>
</person-group> (<year>2012</year>). <article-title>Antibacterial Activity and Mechanism of a Scorpion Venom Peptide Derivative <italic>In Vitro</italic> and <italic>In Vivo</italic>
</article-title>. <source>PloS one</source> <volume>7</volume> (<issue>7</issue>), <fpage>e40135</fpage>. <pub-id pub-id-type="doi">10.1371/journal.pone.0040135</pub-id> </citation>
</ref>
<ref id="B23">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Carmona</surname>
<given-names>G.</given-names>
</name>
<name>
<surname>Rodriguez</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Juarez</surname>
<given-names>D.</given-names>
</name>
<name>
<surname>Corzo</surname>
<given-names>G.</given-names>
</name>
<name>
<surname>Villegas</surname>
<given-names>E.</given-names>
</name>
</person-group> (<year>2013</year>). <article-title>Improved Protease Stability of the Antimicrobial Peptide Pin2 Substituted with D-Amino Acids</article-title>. <source>Protein J.</source> <volume>32</volume> (<issue>6</issue>), <fpage>456</fpage>&#x2013;<lpage>466</lpage>. <pub-id pub-id-type="doi">10.1007/s10930-013-9505-2</pub-id> </citation>
</ref>
<ref id="B24">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Chang</surname>
<given-names>T.-W.</given-names>
</name>
<name>
<surname>Wei</surname>
<given-names>S.-Y.</given-names>
</name>
<name>
<surname>Wang</surname>
<given-names>S.-H.</given-names>
</name>
<name>
<surname>Wei</surname>
<given-names>H.-M.</given-names>
</name>
<name>
<surname>Wang</surname>
<given-names>Y.-J.</given-names>
</name>
<name>
<surname>Wang</surname>
<given-names>C.-F.</given-names>
</name>
<etal/>
</person-group> (<year>2017</year>). <article-title>Hydrophobic Residues Are Critical for the Helix-Forming, Hemolytic and Bactericidal Activities of Amphipathic Antimicrobial Peptide TP4</article-title>. <source>PloS one</source> <volume>12</volume> (<issue>10</issue>), <fpage>e0186442</fpage>. <pub-id pub-id-type="doi">10.1371/journal.pone.0186442</pub-id> </citation>
</ref>
<ref id="B25">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Cheng</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Sun</surname>
<given-names>F.</given-names>
</name>
<name>
<surname>Li</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Gao</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Wang</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Sarhan</surname>
<given-names>M.</given-names>
</name>
<etal/>
</person-group> (<year>2020</year>). <article-title>Inhibitory Activity of a Scorpion Defensin BmKDfsin3 against Hepatitis C Virus</article-title>. <source>Antibiotics</source> <volume>9</volume> (<issue>1</issue>), <fpage>33</fpage>. <pub-id pub-id-type="doi">10.3390/antibiotics9010033</pub-id> </citation>
</ref>
<ref id="B26">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Cherkasov</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Hilpert</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Jenssen</surname>
<given-names>H.</given-names>
</name>
<name>
<surname>Fjell</surname>
<given-names>C. D.</given-names>
</name>
<name>
<surname>Waldbrook</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Mullaly</surname>
<given-names>S. C.</given-names>
</name>
<etal/>
</person-group> (<year>2009</year>). <article-title>Use of Artificial Intelligence in the Design of Small Peptide Antibiotics Effective against a Broad Spectrum of Highly Antibiotic-Resistant Superbugs</article-title>. <source>ACS Chem. Biol.</source> <volume>4</volume> (<issue>1</issue>), <fpage>65</fpage>&#x2013;<lpage>74</lpage>. <pub-id pub-id-type="doi">10.1021/cb800240j</pub-id> </citation>
</ref>
<ref id="B27">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Cherry</surname>
<given-names>M. A.</given-names>
</name>
<name>
<surname>Higgins</surname>
<given-names>S. K.</given-names>
</name>
<name>
<surname>Melroy</surname>
<given-names>H.</given-names>
</name>
<name>
<surname>Lee</surname>
<given-names>H.-S.</given-names>
</name>
<name>
<surname>Pokorny</surname>
<given-names>A.</given-names>
</name>
</person-group> (<year>2014</year>). <article-title>Peptides with the Same Composition, Hydrophobicity, and Hydrophobic Moment Bind to Phospholipid Bilayers with Different Affinities</article-title>. <source>J. Phys. Chem. B</source> <volume>118</volume> (<issue>43</issue>), <fpage>12462</fpage>&#x2013;<lpage>12470</lpage>. <pub-id pub-id-type="doi">10.1021/jp507289w</pub-id> </citation>
</ref>
<ref id="B28">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Christophersen</surname>
<given-names>P. C.</given-names>
</name>
<name>
<surname>Zhang</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>M&#xfc;llertz</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Nielsen</surname>
<given-names>H. M.</given-names>
</name>
<name>
<surname>Yang</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Mu</surname>
<given-names>H.</given-names>
</name>
</person-group> (<year>2014</year>). <article-title>Solid Lipid Particles for Oral Delivery of Peptide and Protein Drugs II - the Digestion of Trilaurin Protects Desmopressin from Proteolytic Degradation</article-title>. <source>Pharm. Res.</source> <volume>31</volume> (<issue>9</issue>), <fpage>2420</fpage>&#x2013;<lpage>2428</lpage>. <pub-id pub-id-type="doi">10.1007/s11095-014-1337-z</pub-id> </citation>
</ref>
<ref id="B29">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Conde</surname>
<given-names>R.</given-names>
</name>
<name>
<surname>Zamudio</surname>
<given-names>F. Z.</given-names>
</name>
<name>
<surname>Rodr&#xed;guez</surname>
<given-names>M. H.</given-names>
</name>
<name>
<surname>Possani</surname>
<given-names>L. D.</given-names>
</name>
</person-group> (<year>2000</year>). <article-title>Scorpine, an Anti-malaria and Anti-bacterial Agent Purified from Scorpion Venom</article-title>. <source>FEBS Lett.</source> <volume>471</volume> (<issue>2-3</issue>), <fpage>165</fpage>&#x2013;<lpage>168</lpage>. <pub-id pub-id-type="doi">10.1016/s0014-5793(00)01384-3</pub-id> </citation>
</ref>
<ref id="B30">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Conlon</surname>
<given-names>J. M.</given-names>
</name>
<name>
<surname>Al-Ghaferi</surname>
<given-names>N.</given-names>
</name>
<name>
<surname>Ahmed</surname>
<given-names>E.</given-names>
</name>
<name>
<surname>Meetani</surname>
<given-names>M. A.</given-names>
</name>
<name>
<surname>Leprince</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Nielsen</surname>
<given-names>P. F.</given-names>
</name>
</person-group> (<year>2010</year>). <article-title>Orthologs of Magainin, PGLa, Procaerulein-Derived, and Proxenopsin-Derived Peptides from Skin Secretions of the Octoploid Frog Xenopus Amieti (Pipidae)</article-title>. <source>Peptides</source> <volume>31</volume> (<issue>6</issue>), <fpage>989</fpage>&#x2013;<lpage>994</lpage>. <pub-id pub-id-type="doi">10.1016/j.peptides.2010.03.002</pub-id> </citation>
</ref>
<ref id="B31">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Corzo</surname>
<given-names>G.</given-names>
</name>
<name>
<surname>Escoubas</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Villegas</surname>
<given-names>E.</given-names>
</name>
<name>
<surname>Barnham</surname>
<given-names>K. J.</given-names>
</name>
<name>
<surname>He</surname>
<given-names>W.</given-names>
</name>
<name>
<surname>Norton</surname>
<given-names>R. S.</given-names>
</name>
<etal/>
</person-group> (<year>2001</year>). <article-title>Characterization of Unique Amphipathic Antimicrobial Peptides from Venom of the Scorpion Pandinus Imperator</article-title>. <source>Biochem. J.</source> <volume>359</volume> (<issue>1</issue>), <fpage>35</fpage>&#x2013;<lpage>45</lpage>. <pub-id pub-id-type="doi">10.1042/bj3590035</pub-id> </citation>
</ref>
<ref id="B32">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Crack</surname>
<given-names>L. R.</given-names>
</name>
<name>
<surname>Jones</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Malavige</surname>
<given-names>G. N.</given-names>
</name>
<name>
<surname>Patel</surname>
<given-names>V.</given-names>
</name>
<name>
<surname>Ogg</surname>
<given-names>G. S.</given-names>
</name>
</person-group> (<year>2012</year>). <article-title>Human Antimicrobial Peptides LL-37 and Human &#x3b2;-defensin-2 Reduce Viral Replication in Keratinocytes Infected with Varicella Zoster Virus</article-title>. <source>Clin. Exp. dermatology</source> <volume>37</volume> (<issue>5</issue>), <fpage>534</fpage>&#x2013;<lpage>543</lpage>. <pub-id pub-id-type="doi">10.1111/j.1365-2230.2012.04305.x</pub-id> </citation>
</ref>
<ref id="B33">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Dai</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Yasuda</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Naoki</surname>
<given-names>H.</given-names>
</name>
<name>
<surname>Corzo</surname>
<given-names>G.</given-names>
</name>
<name>
<surname>Andriantsiferana</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Nakajima</surname>
<given-names>T.</given-names>
</name>
</person-group> (<year>2001</year>). <article-title>IsCT, a Novel Cytotoxic Linear Peptide from Scorpion Opisthacanthus Madagascariensis</article-title>. <source>Biochem. biophysical Res. Commun.</source> <volume>286</volume> (<issue>4</issue>), <fpage>820</fpage>&#x2013;<lpage>825</lpage>. <pub-id pub-id-type="doi">10.1006/bbrc.2001.5472</pub-id> </citation>
</ref>
<ref id="B34">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Daniele-Silva</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Machado</surname>
<given-names>R. J. A.</given-names>
</name>
<name>
<surname>Monteiro</surname>
<given-names>N. K. V.</given-names>
</name>
<name>
<surname>Estrela</surname>
<given-names>A. B.</given-names>
</name>
<name>
<surname>Santos</surname>
<given-names>E. C. G.</given-names>
</name>
<name>
<surname>Carvalho</surname>
<given-names>E.</given-names>
</name>
<etal/>
</person-group> (<year>2016</year>). <article-title>Stigmurin and TsAP-2 from Tityus Stigmurus Scorpion Venom: Assessment of Structure and Therapeutic Potential in Experimental Sepsis</article-title>. <source>Toxicon</source> <volume>121</volume>, <fpage>10</fpage>&#x2013;<lpage>21</lpage>. <pub-id pub-id-type="doi">10.1016/j.toxicon.2016.08.016</pub-id> </citation>
</ref>
<ref id="B35">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Daniele-Silva</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Rodrigues</surname>
<given-names>S. d. C. S.</given-names>
</name>
<name>
<surname>Dos Santos</surname>
<given-names>E. C. G.</given-names>
</name>
<name>
<surname>Queiroz Neto</surname>
<given-names>M. F. d.</given-names>
</name>
<name>
<surname>Rocha</surname>
<given-names>H. A. d. O.</given-names>
</name>
<name>
<surname>Silva-J&#xfa;nior</surname>
<given-names>A. A. d.</given-names>
</name>
<etal/>
</person-group> (<year>2021</year>). <article-title>NMR Three-Dimensional Structure of the Cationic Peptide Stigmurin from Tityus Stigmurus Scorpion Venom: <italic>In Vitro</italic> Antioxidant and <italic>In Vivo</italic> Antibacterial and Healing Activity</article-title>. <source>Peptides</source> <volume>137</volume>, <fpage>170478</fpage>. <pub-id pub-id-type="doi">10.1016/j.peptides.2020.170478</pub-id> </citation>
</ref>
<ref id="B36">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Dathe</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Wieprecht</surname>
<given-names>T.</given-names>
</name>
</person-group> (<year>1999</year>). <article-title>Structural Features of Helical Antimicrobial Peptides: Their Potential to Modulate Activity on Model Membranes and Biological Cells</article-title>. <source>Biochim. Biophys. Acta</source> <volume>1462</volume> (<issue>1-2</issue>), <fpage>71</fpage>&#x2013;<lpage>87</lpage>. <pub-id pub-id-type="doi">10.1016/s0005-2736(99)00201-1</pub-id> </citation>
</ref>
<ref id="B37">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Dathe</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Sch&#xfc;mann</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Wieprecht</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>Winkler</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Beyermann</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Krause</surname>
<given-names>E.</given-names>
</name>
<etal/>
</person-group> (<year>1996</year>). <article-title>Peptide Helicity and Membrane Surface Charge Modulate the Balance of Electrostatic and Hydrophobic Interactions with Lipid Bilayers and Biological Membranes</article-title>. <source>Biochemistry</source> <volume>35</volume> (<issue>38</issue>), <fpage>12612</fpage>&#x2013;<lpage>12622</lpage>. <pub-id pub-id-type="doi">10.1021/bi960835f</pub-id> </citation>
</ref>
<ref id="B38">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>de la Salud Bea</surname>
<given-names>R.</given-names>
</name>
<name>
<surname>Ascuitto</surname>
<given-names>M. R.</given-names>
</name>
<name>
<surname>de Johnson</surname>
<given-names>L. E. L.</given-names>
</name>
</person-group> (<year>2015</year>). <article-title>Synthesis of Analogs of Peptides from Buthus Martensii Scorpion Venom with Potential Antibiotic Activity</article-title>. <source>Peptides</source> <volume>68</volume>, <fpage>228</fpage>&#x2013;<lpage>232</lpage>. <pub-id pub-id-type="doi">10.1016/j.peptides.2014.10.008</pub-id> </citation>
</ref>
<ref id="B39">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>de la Salud Bea</surname>
<given-names>R.</given-names>
</name>
<name>
<surname>Petraglia</surname>
<given-names>A. F.</given-names>
</name>
<name>
<surname>Ascuitto</surname>
<given-names>M. R.</given-names>
</name>
<name>
<surname>Buck</surname>
<given-names>Q. M.</given-names>
</name>
</person-group> (<year>2017</year>). <article-title>Antibacterial Activity and Toxicity of Analogs of Scorpion Venom IsCT Peptides</article-title>. <source>Antibiotics</source> <volume>6</volume> (<issue>3</issue>), <fpage>13</fpage>. </citation>
</ref>
<ref id="B40">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>de Melo</surname>
<given-names>E. T.</given-names>
</name>
<name>
<surname>Estrela</surname>
<given-names>A. B.</given-names>
</name>
<name>
<surname>Santos</surname>
<given-names>E. C. G.</given-names>
</name>
<name>
<surname>Machado</surname>
<given-names>P. R. L.</given-names>
</name>
<name>
<surname>Farias</surname>
<given-names>K. J. S.</given-names>
</name>
<name>
<surname>Torres</surname>
<given-names>T. M.</given-names>
</name>
<etal/>
</person-group> (<year>2015</year>). <article-title>Structural Characterization of a Novel Peptide with Antimicrobial Activity from the Venom Gland of the Scorpion Tityus Stigmurus: Stigmurin</article-title>. <source>Peptides</source> <volume>68</volume>, <fpage>3</fpage>&#x2013;<lpage>10</lpage>. <pub-id pub-id-type="doi">10.1016/j.peptides.2015.03.003</pub-id> </citation>
</ref>
<ref id="B41">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>de Melo</surname>
<given-names>M. M. A.</given-names>
</name>
<name>
<surname>Oliveira</surname>
<given-names>V. D. S.</given-names>
</name>
<name>
<surname>de Queiroz Neto</surname>
<given-names>M. F.</given-names>
</name>
<name>
<surname>Paiva</surname>
<given-names>W. S.</given-names>
</name>
<name>
<surname>Torres-R&#xea;go</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Silva</surname>
<given-names>S. R. B.</given-names>
</name>
<etal/>
</person-group> (<year>2021</year>). <article-title>TanP: A Multifunctional Anionic Peptide from Tityus Stigmurus Scorpion Venom</article-title>. <source>Front. Mol. Biosci.</source> <volume>8</volume>, <fpage>785316</fpage>. <pub-id pub-id-type="doi">10.3389/fmolb.2021.785316</pub-id> </citation>
</ref>
<ref id="B42">
<citation citation-type="web">
<person-group person-group-type="author">
<name>
<surname>DeLano</surname>
<given-names>W. L.</given-names>
</name>
</person-group> (<year>2002</year>). <article-title>The PyMOL Molecular Graphics System</article-title>. <comment>Available at: <ext-link ext-link-type="uri" xlink:href="http://www.pymol.org">http://www.pymol.org</ext-link>
</comment>. </citation>
</ref>
<ref id="B43">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Dennison</surname>
<given-names>M. S. R.</given-names>
</name>
<name>
<surname>Mura</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Harris</surname>
<given-names>F.</given-names>
</name>
<name>
<surname>Morton</surname>
<given-names>L. H. G.</given-names>
</name>
<name>
<surname>Zvelindovsky</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Phoenix</surname>
<given-names>D. A.</given-names>
</name>
</person-group> (<year>2015</year>). <article-title>The Role of C-Terminal Amidation in the Membrane Interactions of the Anionic Antimicrobial Peptide, Maximin H5</article-title>. <source>Biochimica Biophysica Acta (BBA) - Biomembr.</source> <volume>1848</volume> (<issue>5</issue>), <fpage>1111</fpage>&#x2013;<lpage>1118</lpage>. <pub-id pub-id-type="doi">10.1016/j.bbamem.2015.01.014</pub-id> </citation>
</ref>
<ref id="B44">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Dennison</surname>
<given-names>S. R.</given-names>
</name>
<name>
<surname>Harris</surname>
<given-names>F.</given-names>
</name>
<name>
<surname>Bhatt</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>Singh</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Phoenix</surname>
<given-names>D. A.</given-names>
</name>
</person-group> (<year>2009</year>). <article-title>The Effect of C-Terminal Amidation on the Efficacy and Selectivity of Antimicrobial and Anticancer Peptides</article-title>. <source>Mol. Cell Biochem.</source> <volume>332</volume> (<issue>1</issue>), <fpage>43</fpage>&#x2013;<lpage>50</lpage>. <pub-id pub-id-type="doi">10.1007/s11010-009-0172-8</pub-id> </citation>
</ref>
<ref id="B45">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Dennison</surname>
<given-names>S. R.</given-names>
</name>
<name>
<surname>Phoenix</surname>
<given-names>D. A.</given-names>
</name>
</person-group> (<year>2011</year>). <article-title>Influence of C-Terminal Amidation on the Efficacy of Modelin-5</article-title>. <source>Biochemistry</source> <volume>50</volume> (<issue>9</issue>), <fpage>1514</fpage>&#x2013;<lpage>1523</lpage>. <pub-id pub-id-type="doi">10.1021/bi101687t</pub-id> </citation>
</ref>
<ref id="B46">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Dennison</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Wallace</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Harris</surname>
<given-names>F.</given-names>
</name>
<name>
<surname>Phoenix</surname>
<given-names>D.</given-names>
</name>
</person-group> (<year>2005</year>). <article-title>Amphiphilic &#x03B1;-Helical Antimicrobial Peptides and Their Structure/Function Relationships</article-title>. <source>Ppl</source> <volume>12</volume> (<issue>1</issue>), <fpage>31</fpage>&#x2013;<lpage>39</lpage>. <pub-id pub-id-type="doi">10.2174/0929866053406084</pub-id> </citation>
</ref>
<ref id="B47">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Divangahi</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Aaby</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Khader</surname>
<given-names>S. A.</given-names>
</name>
<name>
<surname>Barreiro</surname>
<given-names>L. B.</given-names>
</name>
<name>
<surname>Bekkering</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Chavakis</surname>
<given-names>T.</given-names>
</name>
<etal/>
</person-group> (<year>2021</year>). <article-title>Trained Immunity, Tolerance, Priming and Differentiation: Distinct Immunological Processes</article-title>. <source>Nat. Immunol.</source> <volume>22</volume> (<issue>1</issue>), <fpage>2</fpage>&#x2013;<lpage>6</lpage>. <pub-id pub-id-type="doi">10.1038/s41590-020-00845-6</pub-id> </citation>
</ref>
<ref id="B48">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Du</surname>
<given-names>Q.</given-names>
</name>
<name>
<surname>Hou</surname>
<given-names>X.</given-names>
</name>
<name>
<surname>Ge</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Li</surname>
<given-names>R.</given-names>
</name>
<name>
<surname>Zhou</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Wang</surname>
<given-names>H.</given-names>
</name>
<etal/>
</person-group> (<year>2014</year>). <article-title>Cationicity-enhanced Analogues of the Antimicrobial Peptides, AcrAP1 and AcrAP2, from the Venom of the Scorpion, Androctonus Crassicauda, Display Potent Growth Modulation Effects on Human Cancer Cell Lines</article-title>. <source>Int. J. Biol. Sci.</source> <volume>10</volume> (<issue>10</issue>), <fpage>1097</fpage>&#x2013;<lpage>1107</lpage>. <pub-id pub-id-type="doi">10.7150/ijbs.9859</pub-id> </citation>
</ref>
<ref id="B49">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Du</surname>
<given-names>Q.</given-names>
</name>
<name>
<surname>Hou</surname>
<given-names>X.</given-names>
</name>
<name>
<surname>Wang</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Zhang</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Xi</surname>
<given-names>X.</given-names>
</name>
<name>
<surname>Wang</surname>
<given-names>H.</given-names>
</name>
<etal/>
</person-group> (<year>2015</year>). <article-title>AaeAP1 and AaeAP2: Novel Antimicrobial Peptides from the Venom of the Scorpion, Androctonus Aeneas: Structural Characterisation, Molecular Cloning of Biosynthetic Precursor-Encoding cDNAs and Engineering of Analogues with Enhanced Antimicrobial and Anticancer Activities</article-title>. <source>Toxins</source> <volume>7</volume> (<issue>2</issue>), <fpage>219</fpage>&#x2013;<lpage>237</lpage>. <pub-id pub-id-type="doi">10.3390/toxins7020219</pub-id> </citation>
</ref>
<ref id="B50">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Epand</surname>
<given-names>R. M.</given-names>
</name>
<name>
<surname>Epand</surname>
<given-names>R. F.</given-names>
</name>
</person-group> (<year>2011</year>). <article-title>Bacterial Membrane Lipids in the Action of Antimicrobial Agents</article-title>. <source>J. Pept. Sci.</source> <volume>17</volume> (<issue>5</issue>), <fpage>298</fpage>&#x2013;<lpage>305</lpage>. <pub-id pub-id-type="doi">10.1002/psc.1319</pub-id> </citation>
</ref>
<ref id="B51">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Erde&#x15f;</surname>
<given-names>E.</given-names>
</name>
<name>
<surname>Do&#x11f;an</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>Co&#x15f;ar</surname>
<given-names>&#x130;.</given-names>
</name>
<name>
<surname>Dan&#x131;&#x15f;man</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>Kunt</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>&#x15e;eker</surname>
<given-names>T.</given-names>
</name>
<etal/>
</person-group> (<year>2014</year>). <article-title>Characterization of Leiurus Abdullahbayrami (Scorpiones: Buthidae) Venom: Peptide Profile, Cytotoxicity and Antimicrobial Activity</article-title>. <source>J. Venom. Anim. Toxins Incl. Trop. Dis.</source> <volume>20</volume> (<issue>1</issue>), <fpage>48</fpage>. <pub-id pub-id-type="doi">10.1186/1678-9199-20-48</pub-id> </citation>
</ref>
<ref id="B52">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Fjell</surname>
<given-names>C. D.</given-names>
</name>
<name>
<surname>Hiss</surname>
<given-names>J. A.</given-names>
</name>
<name>
<surname>Hancock</surname>
<given-names>R. E. W.</given-names>
</name>
<name>
<surname>Schneider</surname>
<given-names>G.</given-names>
</name>
</person-group> (<year>2012</year>). <article-title>Designing Antimicrobial Peptides: Form Follows Function</article-title>. <source>Nat. Rev. Drug Discov.</source> <volume>11</volume> (<issue>1</issue>), <fpage>37</fpage>&#x2013;<lpage>51</lpage>. <pub-id pub-id-type="doi">10.1038/nrd3591</pub-id> </citation>
</ref>
<ref id="B53">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Fuscaldi</surname>
<given-names>L. L.</given-names>
</name>
<name>
<surname>de Avelar J&#xfa;nior</surname>
<given-names>J. T.</given-names>
</name>
<name>
<surname>Dos Santos</surname>
<given-names>D. M.</given-names>
</name>
<name>
<surname>Boff</surname>
<given-names>D.</given-names>
</name>
<name>
<surname>de Oliveira</surname>
<given-names>V. L. S.</given-names>
</name>
<name>
<surname>Gomes</surname>
<given-names>K. A. G. G.</given-names>
</name>
<etal/>
</person-group> (<year>2021</year>). <article-title>Shortened Derivatives from Native Antimicrobial Peptide LyeTx I: <italic>In Vitro</italic> and <italic>In Vivo</italic> Biological Activity Assessment</article-title>. <source>Exp. Biol. Med. (Maywood)</source> <volume>246</volume> (<issue>4</issue>), <fpage>414</fpage>&#x2013;<lpage>425</lpage>. <pub-id pub-id-type="doi">10.1177/1535370220966963</pub-id> </citation>
</ref>
<ref id="B54">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Gagnon</surname>
<given-names>M.-C.</given-names>
</name>
<name>
<surname>Strandberg</surname>
<given-names>E.</given-names>
</name>
<name>
<surname>Grau-Campistany</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Wadhwani</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Reichert</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>B&#xfc;rck</surname>
<given-names>J.</given-names>
</name>
<etal/>
</person-group> (<year>2017</year>). <article-title>Influence of the Length and Charge on the Activity of &#x3b1;-Helical Amphipathic Antimicrobial Peptides</article-title>. <source>Biochemistry</source> <volume>56</volume> (<issue>11</issue>), <fpage>1680</fpage>&#x2013;<lpage>1695</lpage>. <pub-id pub-id-type="doi">10.1021/acs.biochem.6b01071</pub-id> </citation>
</ref>
<ref id="B55">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Gao</surname>
<given-names>B.</given-names>
</name>
<name>
<surname>Sherman</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Luo</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Bowie</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Zhu</surname>
<given-names>S.</given-names>
</name>
</person-group> (<year>2009</year>). <article-title>Structural and Functional Characterization of Two Genetically Related Meucin Peptides Highlights Evolutionary Divergence and Convergence in Antimicrobial Peptides</article-title>. <source>FASEB J.</source> <volume>23</volume> (<issue>4</issue>), <fpage>1230</fpage>&#x2013;<lpage>1245</lpage>. <pub-id pub-id-type="doi">10.1096/fj.08-122317</pub-id> </citation>
</ref>
<ref id="B56">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Gao</surname>
<given-names>B.</given-names>
</name>
<name>
<surname>Xu</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>del Carmen Rodriguez</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Lanz-Mendoza</surname>
<given-names>H.</given-names>
</name>
<name>
<surname>Hern&#xe1;ndez-Rivas</surname>
<given-names>R.</given-names>
</name>
<name>
<surname>Du</surname>
<given-names>W.</given-names>
</name>
<etal/>
</person-group> (<year>2010</year>). <article-title>Characterization of Two Linear Cationic Antimalarial Peptides in the Scorpion Mesobuthus Eupeus</article-title>. <source>Biochimie</source> <volume>92</volume> (<issue>4</issue>), <fpage>350</fpage>&#x2013;<lpage>359</lpage>. <pub-id pub-id-type="doi">10.1016/j.biochi.2010.01.011</pub-id> </citation>
</ref>
<ref id="B57">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Gim&#xe9;nez-Andr&#xe9;s</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>&#x10c;opi&#x10d;</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Antonny</surname>
<given-names>B.</given-names>
</name>
</person-group> (<year>2018</year>). <article-title>The Many Faces of Amphipathic Helices</article-title>. <source>Biomolecules</source> <volume>8</volume> (<issue>3</issue>), <fpage>45</fpage>. <pub-id pub-id-type="doi">10.3390/biom8030045</pub-id> </citation>
</ref>
<ref id="B58">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Gong</surname>
<given-names>D.</given-names>
</name>
<name>
<surname>Wilson</surname>
<given-names>P. W.</given-names>
</name>
<name>
<surname>Bain</surname>
<given-names>M. M.</given-names>
</name>
<name>
<surname>McDade</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Kalina</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Herv&#xe9;-Gr&#xe9;pinet</surname>
<given-names>V.</given-names>
</name>
<etal/>
</person-group> (<year>2010</year>). <article-title>Gallin; an Antimicrobial Peptide Member of a New Avian Defensin Family, the Ovodefensins, Has Been Subject to Recent Gene Duplication</article-title>. <source>BMC Immunol.</source> <volume>11</volume> (<issue>1</issue>), <fpage>12</fpage>. <pub-id pub-id-type="doi">10.1186/1471-2172-11-12</pub-id> </citation>
</ref>
<ref id="B59">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Gopal</surname>
<given-names>R.</given-names>
</name>
<name>
<surname>Seo</surname>
<given-names>C. H.</given-names>
</name>
<name>
<surname>Song</surname>
<given-names>P. I.</given-names>
</name>
<name>
<surname>Park</surname>
<given-names>Y.</given-names>
</name>
</person-group> (<year>2013</year>). <article-title>Effect of Repetitive Lysine-Tryptophan Motifs on the Bactericidal Activity of Antimicrobial Peptides</article-title>. <source>Amino acids</source> <volume>44</volume> (<issue>2</issue>), <fpage>645</fpage>&#x2013;<lpage>660</lpage>. <pub-id pub-id-type="doi">10.1007/s00726-012-1388-6</pub-id> </citation>
</ref>
<ref id="B60">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Gro&#xdf;</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Hashimoto</surname>
<given-names>C.</given-names>
</name>
<name>
<surname>Sticht</surname>
<given-names>H.</given-names>
</name>
<name>
<surname>Eichler</surname>
<given-names>J.</given-names>
</name>
</person-group> (<year>2016</year>). <article-title>Synthetic Peptides as Protein Mimics</article-title>. <source>Front. Bioeng. Biotechnol.</source> <volume>3</volume>, <fpage>211</fpage>. <pub-id pub-id-type="doi">10.3389/fbioe.2015.00211</pub-id> </citation>
</ref>
<ref id="B61">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Guilhelmelli</surname>
<given-names>F.</given-names>
</name>
<name>
<surname>Vilela</surname>
<given-names>N.</given-names>
</name>
<name>
<surname>Albuquerque</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Derengowski</surname>
<given-names>L. d. S.</given-names>
</name>
<name>
<surname>Silva-Pereira</surname>
<given-names>I.</given-names>
</name>
<name>
<surname>Kyaw</surname>
<given-names>C. M.</given-names>
</name>
</person-group> (<year>2013</year>). <article-title>Antibiotic Development Challenges: the Various Mechanisms of Action of Antimicrobial Peptides and of Bacterial Resistance</article-title>. <source>Front. Microbiol.</source> <volume>4</volume>, <fpage>353</fpage>. <pub-id pub-id-type="doi">10.3389/fmicb.2013.00353</pub-id> </citation>
</ref>
<ref id="B62">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Guo</surname>
<given-names>X.</given-names>
</name>
<name>
<surname>Ma</surname>
<given-names>C.</given-names>
</name>
<name>
<surname>Du</surname>
<given-names>Q.</given-names>
</name>
<name>
<surname>Wei</surname>
<given-names>R.</given-names>
</name>
<name>
<surname>Wang</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Zhou</surname>
<given-names>M.</given-names>
</name>
<etal/>
</person-group> (<year>2013</year>). <article-title>Two Peptides, TsAP-1 and TsAP-2, from the Venom of the Brazilian Yellow Scorpion, Tityus Serrulatus: Evaluation of Their Antimicrobial and Anticancer Activities</article-title>. <source>Biochimie</source> <volume>95</volume> (<issue>9</issue>), <fpage>1784</fpage>&#x2013;<lpage>1794</lpage>. <pub-id pub-id-type="doi">10.1016/j.biochi.2013.06.003</pub-id> </citation>
</ref>
<ref id="B63">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Hancock</surname>
<given-names>R. E.</given-names>
</name>
</person-group> (<year>1997</year>). <article-title>Peptide Antibiotics</article-title>. <source>Lancet</source> <volume>349</volume> (<issue>9049</issue>), <fpage>418</fpage>&#x2013;<lpage>422</lpage>. <pub-id pub-id-type="doi">10.1016/s0140-6736(97)80051-7</pub-id> </citation>
</ref>
<ref id="B64">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Hancock</surname>
<given-names>R. E. W.</given-names>
</name>
<name>
<surname>Falla</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>Brown</surname>
<given-names>M.</given-names>
</name>
</person-group> (<year>1995</year>). <article-title>Cationic Bactericidal Peptides</article-title>. <source>Advances in Microbial Physiology</source> <volume>37</volume>, <fpage>135</fpage>&#x2013;<lpage>175</lpage>. <pub-id pub-id-type="doi">10.1016/s0065-2911(08)60145-9</pub-id> </citation>
</ref>
<ref id="B65">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Hancock</surname>
<given-names>R. E. W.</given-names>
</name>
<name>
<surname>Sahl</surname>
<given-names>H.-G.</given-names>
</name>
</person-group> (<year>2006</year>). <article-title>Antimicrobial and Host-Defense Peptides as New Anti-infective Therapeutic Strategies</article-title>. <source>Nat. Biotechnol.</source> <volume>24</volume> (<issue>12</issue>), <fpage>1551</fpage>&#x2013;<lpage>1557</lpage>. <pub-id pub-id-type="doi">10.1038/nbt1267</pub-id> </citation>
</ref>
<ref id="B66">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Harrison</surname>
<given-names>P. L.</given-names>
</name>
<name>
<surname>Abdel-Rahman</surname>
<given-names>M. A.</given-names>
</name>
<name>
<surname>Miller</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Strong</surname>
<given-names>P. N.</given-names>
</name>
</person-group> (<year>2014</year>). <article-title>Antimicrobial Peptides from Scorpion Venoms</article-title>. <source>Toxicon</source> <volume>88</volume>, <fpage>115</fpage>&#x2013;<lpage>137</lpage>. <pub-id pub-id-type="doi">10.1016/j.toxicon.2014.06.006</pub-id> </citation>
</ref>
<ref id="B67">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Hern&#xe1;ndez-Aponte</surname>
<given-names>C. A.</given-names>
</name>
<name>
<surname>Silva-Sanchez</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Quintero-Hern&#xe1;ndez</surname>
<given-names>V.</given-names>
</name>
<name>
<surname>Rodr&#xed;guez-Romero</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Balderas</surname>
<given-names>C.</given-names>
</name>
<name>
<surname>Possani</surname>
<given-names>L. D.</given-names>
</name>
<etal/>
</person-group> (<year>2011</year>). <article-title>Vejovine, a New Antibiotic from the Scorpion Venom of Vaejovis Mexicanus</article-title>. <source>Toxicon</source> <volume>57</volume> (<issue>1</issue>), <fpage>84</fpage>&#x2013;<lpage>92</lpage>. <pub-id pub-id-type="doi">10.1016/j.toxicon.2010.10.008</pub-id> </citation>
</ref>
<ref id="B68">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Huang</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Huang</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Chen</surname>
<given-names>Y.</given-names>
</name>
</person-group> (<year>2010</year>). <article-title>Alpha-helical Cationic Antimicrobial Peptides: Relationships of Structure and Function</article-title>. <source>Protein Cell</source> <volume>1</volume> (<issue>2</issue>), <fpage>143</fpage>&#x2013;<lpage>152</lpage>. <pub-id pub-id-type="doi">10.1007/s13238-010-0004-3</pub-id> </citation>
</ref>
<ref id="B69">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Jenssen</surname>
<given-names>H.</given-names>
</name>
<name>
<surname>Hamill</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Hancock</surname>
<given-names>R. E. W.</given-names>
</name>
</person-group> (<year>2006</year>). <article-title>Peptide Antimicrobial Agents</article-title>. <source>Clin. Microbiol. Rev.</source> <volume>19</volume> (<issue>3</issue>), <fpage>491</fpage>&#x2013;<lpage>511</lpage>. <pub-id pub-id-type="doi">10.1128/cmr.00056-05</pub-id> </citation>
</ref>
<ref id="B70">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Karmakar</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Maity</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Halder</surname>
<given-names>A.</given-names>
</name>
</person-group> (<year>2019</year>). <article-title>Antimicrobial Peptide Nk-2 as an Emerging Therapeutic Agent: a Study with Phospholipid Membranes</article-title>. <source>Mater. Today Proc.</source> <volume>18</volume>, <fpage>879</fpage>&#x2013;<lpage>886</lpage>. <pub-id pub-id-type="doi">10.1016/j.matpr.2019.06.518</pub-id> </citation>
</ref>
<ref id="B71">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Kim</surname>
<given-names>M. K.</given-names>
</name>
<name>
<surname>Kang</surname>
<given-names>H. K.</given-names>
</name>
<name>
<surname>Ko</surname>
<given-names>S. J.</given-names>
</name>
<name>
<surname>Hong</surname>
<given-names>M. J.</given-names>
</name>
<name>
<surname>Bang</surname>
<given-names>J. K.</given-names>
</name>
<name>
<surname>Seo</surname>
<given-names>C. H.</given-names>
</name>
<etal/>
</person-group> (<year>2018</year>). <article-title>Mechanisms Driving the Antibacterial and Antibiofilm Properties of Hp1404 and its Analogue Peptides against Multidrug-Resistant <italic>Pseudomonas aeruginosa</italic>
</article-title>. <source>Sci. Rep.</source> <volume>8</volume> (<issue>1</issue>), <fpage>1763</fpage>. <pub-id pub-id-type="doi">10.1038/s41598-018-19434-7</pub-id> </citation>
</ref>
<ref id="B72">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Kiyota</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>Lee</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Sugihara</surname>
<given-names>G.</given-names>
</name>
</person-group> (<year>1996</year>). <article-title>Design and Synthesis of Amphiphilic &#x3b1;-Helical Model Peptides with Systematically Varied Hydrophobic&#x2212;Hydrophilic Balance and Their Interaction with Lipid- and Bio-Membranes</article-title>. <source>Biochemistry</source> <volume>35</volume> (<issue>40</issue>), <fpage>13196</fpage>&#x2013;<lpage>13204</lpage>. <pub-id pub-id-type="doi">10.1021/bi961289t</pub-id> </citation>
</ref>
<ref id="B73">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Kotra</surname>
<given-names>L. P.</given-names>
</name>
<name>
<surname>Golemi</surname>
<given-names>D.</given-names>
</name>
<name>
<surname>Amro</surname>
<given-names>N. A.</given-names>
</name>
<name>
<surname>Liu</surname>
<given-names>G.-Y.</given-names>
</name>
<name>
<surname>Mobashery</surname>
<given-names>S.</given-names>
</name>
</person-group> (<year>1999</year>). <article-title>Dynamics of the Lipopolysaccharide Assembly on the Surface of <italic>Escherichia coli</italic>
</article-title>. <source>J. Am. Chem. Soc.</source> <volume>121</volume> (<issue>38</issue>), <fpage>8707</fpage>&#x2013;<lpage>8711</lpage>. <pub-id pub-id-type="doi">10.1021/ja991374z</pub-id> </citation>
</ref>
<ref id="B74">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Kumar</surname>
<given-names>D.</given-names>
</name>
<name>
<surname>Bhalla</surname>
<given-names>T. C.</given-names>
</name>
</person-group> (<year>2005</year>). <article-title>Microbial Proteases in Peptide Synthesis: Approaches and Applications</article-title>. <source>Appl. Microbiol. Biotechnol.</source> <volume>68</volume> (<issue>6</issue>), <fpage>726</fpage>&#x2013;<lpage>736</lpage>. <pub-id pub-id-type="doi">10.1007/s00253-005-0094-7</pub-id> </citation>
</ref>
<ref id="B75">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Lang</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Pi</surname>
<given-names>X.</given-names>
</name>
<name>
<surname>Di</surname>
<given-names>Z.</given-names>
</name>
<name>
<surname>Zhang</surname>
<given-names>Q.</given-names>
</name>
<name>
<surname>Wang</surname>
<given-names>H.</given-names>
</name>
<name>
<surname>Shen</surname>
<given-names>B.</given-names>
</name>
<etal/>
</person-group> (<year>2017</year>). <article-title>Molecular Characterization and Expression Analysis of CS&#x3b1;&#x3b2; Defensin Genes from the Scorpion Mesobuthus Martensii</article-title>. <source>Biosci. Rep.</source> <volume>37</volume> (<issue>6</issue>). <pub-id pub-id-type="doi">10.1042/BSR20171282</pub-id> </citation>
</ref>
<ref id="B76">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Lee</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Shin</surname>
<given-names>S. Y.</given-names>
</name>
<name>
<surname>Kim</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Lim</surname>
<given-names>S. S.</given-names>
</name>
<name>
<surname>Hahm</surname>
<given-names>K.-S.</given-names>
</name>
<name>
<surname>Kim</surname>
<given-names>Y.</given-names>
</name>
</person-group> (<year>2004</year>). <article-title>Antibiotic Activity and Structural Analysis of the Scorpion-Derived Antimicrobial Peptide IsCT and its Analogs</article-title>. <source>Biochem. biophysical Res. Commun.</source> <volume>323</volume> (<issue>2</issue>), <fpage>712</fpage>&#x2013;<lpage>719</lpage>. <pub-id pub-id-type="doi">10.1016/j.bbrc.2004.08.144</pub-id> </citation>
</ref>
<ref id="B77">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Lee</surname>
<given-names>S. H.</given-names>
</name>
<name>
<surname>Kim</surname>
<given-names>S. J.</given-names>
</name>
<name>
<surname>Lee</surname>
<given-names>Y. S.</given-names>
</name>
<name>
<surname>Song</surname>
<given-names>M. D.</given-names>
</name>
<name>
<surname>Kim</surname>
<given-names>I. H.</given-names>
</name>
<name>
<surname>Won</surname>
<given-names>H. S.</given-names>
</name>
</person-group> (<year>2011</year>). <article-title>De Novo generation of Short Antimicrobial Peptides with Simple Amino Acid Composition</article-title>. <source>Regul. Pept.</source> <volume>166</volume> (<issue>1-3</issue>), <fpage>36</fpage>&#x2013;<lpage>41</lpage>. <pub-id pub-id-type="doi">10.1016/j.regpep.2010.08.010</pub-id> </citation>
</ref>
<ref id="B78">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Leite</surname>
<given-names>N. B.</given-names>
</name>
<name>
<surname>Aufderhorst-Roberts</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Palma</surname>
<given-names>M. S.</given-names>
</name>
<name>
<surname>Connell</surname>
<given-names>S. D.</given-names>
</name>
<name>
<surname>Neto</surname>
<given-names>J. R.</given-names>
</name>
<name>
<surname>Beales</surname>
<given-names>P. A.</given-names>
</name>
</person-group> (<year>2015</year>). <article-title>PE and PS Lipids Synergistically Enhance Membrane Poration by a Peptide with Anticancer Properties</article-title>. <source>Biophysical J.</source> <volume>109</volume> (<issue>5</issue>), <fpage>936</fpage>&#x2013;<lpage>947</lpage>. <pub-id pub-id-type="doi">10.1016/j.bpj.2015.07.033</pub-id> </citation>
</ref>
<ref id="B79">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Li</surname>
<given-names>F. F.</given-names>
</name>
<name>
<surname>Brimble</surname>
<given-names>M. A.</given-names>
</name>
</person-group> (<year>2019</year>). <article-title>Using Chemical Synthesis to Optimise Antimicrobial Peptides in the Fight against Antimicrobial Resistance</article-title>. <source>Pure Appl. Chem.</source> <volume>91</volume> (<issue>2</issue>), <fpage>181</fpage>&#x2013;<lpage>198</lpage>. <pub-id pub-id-type="doi">10.1515/pac-2018-0704</pub-id> </citation>
</ref>
<ref id="B80">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Li</surname>
<given-names>Z.</given-names>
</name>
<name>
<surname>Xu</surname>
<given-names>X.</given-names>
</name>
<name>
<surname>Meng</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Zhang</surname>
<given-names>Q.</given-names>
</name>
<name>
<surname>Cao</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Li</surname>
<given-names>W.</given-names>
</name>
<etal/>
</person-group> (<year>2014</year>). <article-title>Hp1404, a New Antimicrobial Peptide from the Scorpion Heterometrus Petersii</article-title>. <source>PloS one</source> <volume>9</volume> (<issue>5</issue>), <fpage>e97539</fpage>. <pub-id pub-id-type="doi">10.1371/journal.pone.0097539</pub-id> </citation>
</ref>
<ref id="B81">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Li</surname>
<given-names>Z.</given-names>
</name>
<name>
<surname>Yuan</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Li</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Deng</surname>
<given-names>B.</given-names>
</name>
<name>
<surname>Wang</surname>
<given-names>Y.</given-names>
</name>
</person-group> (<year>2020</year>). <article-title>Antibacterial Activity of a Scorpion-Derived Peptide and its Derivatives <italic>In Vitro</italic> and <italic>In Vivo</italic>
</article-title>. <source>Toxicon</source> <volume>186</volume>, <fpage>35</fpage>&#x2013;<lpage>41</lpage>. <pub-id pub-id-type="doi">10.1016/j.toxicon.2020.07.028</pub-id> </citation>
</ref>
<ref id="B82">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Luna-Ramirez</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Tonk</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Rahnamaeian</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Vilcinskas</surname>
<given-names>A.</given-names>
</name>
</person-group> (<year>2017</year>). <article-title>Bioactivity of Natural and Engineered Antimicrobial Peptides from Venom of the Scorpions Urodacus Yaschenkoi and U. Manicatus</article-title>. <source>Toxins</source> <volume>9</volume> (<issue>1</issue>), <fpage>22</fpage>. <pub-id pub-id-type="doi">10.3390/toxins9010022</pub-id> </citation>
</ref>
<ref id="B83">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Luo</surname>
<given-names>X.</given-names>
</name>
<name>
<surname>Ye</surname>
<given-names>X.</given-names>
</name>
<name>
<surname>Ding</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Zhu</surname>
<given-names>W.</given-names>
</name>
<name>
<surname>Yi</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Zhao</surname>
<given-names>Z.</given-names>
</name>
<etal/>
</person-group> (<year>2021</year>). <article-title>Corrigendum: Fine-Tuning of Alkaline Residues on the Hydrophilic Face Provides a Non-toxic Cationic &#x3b1;-Helical Antimicrobial Peptide against Antibiotic-Resistant ESKAPE Pathogens</article-title>. <source>Front. Microbiol.</source> <volume>12</volume>, <fpage>3817</fpage>. <pub-id pub-id-type="doi">10.3389/fmicb.2021.815909</pub-id> </citation>
</ref>
<ref id="B84">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Luplertlop</surname>
<given-names>N.</given-names>
</name>
<name>
<surname>Surasombatpattana</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Patramool</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Dumas</surname>
<given-names>E.</given-names>
</name>
<name>
<surname>Wasinpiyamongkol</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Saune</surname>
<given-names>L.</given-names>
</name>
<etal/>
</person-group> (<year>2011</year>). <article-title>Induction of a Peptide with Activity against a Broad Spectrum of Pathogens in the <italic>Aedes aegypti</italic> Salivary Gland, Following Infection with Dengue Virus</article-title>. <source>PLoS Pathog.</source> <volume>7</volume> (<issue>1</issue>), <fpage>e1001252</fpage>. <pub-id pub-id-type="doi">10.1371/journal.ppat.1001252</pub-id> </citation>
</ref>
<ref id="B85">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Lyapina</surname>
<given-names>I.</given-names>
</name>
<name>
<surname>Filippova</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Fesenko</surname>
<given-names>I.</given-names>
</name>
</person-group> (<year>2019</year>). <article-title>The Role of Peptide Signals Hidden in the Structure of Functional Proteins in Plant Immune Responses</article-title>. <source>Ijms</source> <volume>20</volume> (<issue>18</issue>), <fpage>4343</fpage>. <pub-id pub-id-type="doi">10.3390/ijms20184343</pub-id> </citation>
</ref>
<ref id="B86">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Malanovic</surname>
<given-names>N.</given-names>
</name>
<name>
<surname>Lohner</surname>
<given-names>K.</given-names>
</name>
</person-group> (<year>2016</year>). <article-title>Antimicrobial Peptides Targeting Gram-Positive Bacteria</article-title>. <source>Pharmaceuticals</source> <volume>9</volume> (<issue>3</issue>), <fpage>59</fpage>. <pub-id pub-id-type="doi">10.3390/ph9030059</pub-id> </citation>
</ref>
<ref id="B87">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Mandard</surname>
<given-names>N.</given-names>
</name>
<name>
<surname>Sy</surname>
<given-names>D.</given-names>
</name>
<name>
<surname>Maufrais</surname>
<given-names>C.</given-names>
</name>
<name>
<surname>Bonmatin</surname>
<given-names>J.-M.</given-names>
</name>
<name>
<surname>Bulet</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Hetru</surname>
<given-names>C.</given-names>
</name>
<etal/>
</person-group> (<year>1999</year>). <article-title>Androctonin, a Novel Antimicrobial Peptide from ScorpionAndroctonus Australis: Solution Structure and Molecular Dynamics Simulations in the Presence of a Lipid Monolayer</article-title>. <source>J. Biomol. Struct. Dyn.</source> <volume>17</volume> (<issue>2</issue>), <fpage>367</fpage>&#x2013;<lpage>380</lpage>. <pub-id pub-id-type="doi">10.1080/07391102.1999.10508368</pub-id> </citation>
</ref>
<ref id="B88">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Matsuzaki</surname>
<given-names>K.</given-names>
</name>
</person-group> (<year>2009</year>). <article-title>Control of Cell Selectivity of Antimicrobial Peptides</article-title>. <source>Biochimica Biophysica Acta (BBA) - Biomembr.</source> <volume>1788</volume> (<issue>8</issue>), <fpage>1687</fpage>&#x2013;<lpage>1692</lpage>. <pub-id pub-id-type="doi">10.1016/j.bbamem.2008.09.013</pub-id> </citation>
</ref>
<ref id="B89">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Maturana</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Martinez</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Noguera</surname>
<given-names>M. E.</given-names>
</name>
<name>
<surname>Santos</surname>
<given-names>N. C.</given-names>
</name>
<name>
<surname>Disalvo</surname>
<given-names>E. A.</given-names>
</name>
<name>
<surname>Semorile</surname>
<given-names>L.</given-names>
</name>
<etal/>
</person-group> (<year>2017</year>). <article-title>Lipid Selectivity in Novel Antimicrobial Peptides: Implication on Antimicrobial and Hemolytic Activity</article-title>. <source>Colloids Surfaces B Biointerfaces</source> <volume>153</volume>, <fpage>152</fpage>&#x2013;<lpage>159</lpage>. <pub-id pub-id-type="doi">10.1016/j.colsurfb.2017.02.003</pub-id> </citation>
</ref>
<ref id="B90">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Miyashita</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Sakai</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Matsushita</surname>
<given-names>N.</given-names>
</name>
<name>
<surname>Hanai</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Nakagawa</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Miyagawa</surname>
<given-names>H.</given-names>
</name>
</person-group> (<year>2010</year>). <article-title>A Novel Amphipathic Linear Peptide with Both Insect Toxicity and Antimicrobial Activity from the Venom of the ScorpionIsometrus Maculatus</article-title>. <source>Biosci. Biotechnol. Biochem.</source> <volume>74</volume> (<issue>2</issue>), <fpage>364</fpage>&#x2013;<lpage>369</lpage>. <pub-id pub-id-type="doi">10.1271/bbb.90723</pub-id> </citation>
</ref>
<ref id="B91">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Moncla</surname>
<given-names>B. J.</given-names>
</name>
<name>
<surname>Pryke</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Rohan</surname>
<given-names>L. C.</given-names>
</name>
<name>
<surname>Graebing</surname>
<given-names>P. W.</given-names>
</name>
</person-group> (<year>2011</year>). <article-title>Degradation of Naturally Occurring and Engineered Antimicrobial Peptides by Proteases</article-title>. <source>Adv. Biosci. Biotechnol.</source> <volume>2</volume> (<issue>6</issue>), <fpage>404</fpage>&#x2013;<lpage>408</lpage>. <pub-id pub-id-type="doi">10.4236/abb.2011.26059</pub-id> </citation>
</ref>
<ref id="B92">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Moreira</surname>
<given-names>I. S.</given-names>
</name>
<name>
<surname>Fernandes</surname>
<given-names>P. A.</given-names>
</name>
<name>
<surname>Ramos</surname>
<given-names>M. J.</given-names>
</name>
</person-group> (<year>2007</year>). <article-title>Hot Spots-A Review of the Protein-Protein Interface Determinant Amino-Acid Residues</article-title>. <source>Proteins</source> <volume>68</volume> (<issue>4</issue>), <fpage>803</fpage>&#x2013;<lpage>812</lpage>. <pub-id pub-id-type="doi">10.1002/prot.21396</pub-id> </citation>
</ref>
<ref id="B93">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Mura</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Wang</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Zhou</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Pinna</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Zvelindovsky</surname>
<given-names>A. V.</given-names>
</name>
<name>
<surname>Dennison</surname>
<given-names>S. R.</given-names>
</name>
<etal/>
</person-group> (<year>2016</year>). <article-title>The Effect of Amidation on the Behaviour of Antimicrobial Peptides</article-title>. <source>Eur. Biophys. J.</source> <volume>45</volume> (<issue>3</issue>), <fpage>195</fpage>&#x2013;<lpage>207</lpage>. <pub-id pub-id-type="doi">10.1007/s00249-015-1094-x</pub-id> </citation>
</ref>
<ref id="B94">
<citation citation-type="book">
<person-group person-group-type="author">
<name>
<surname>Nelson</surname>
<given-names>D. L.</given-names>
</name>
<name>
<surname>Lehninger</surname>
<given-names>A. L.</given-names>
</name>
<name>
<surname>Cox</surname>
<given-names>M. M.</given-names>
</name>
</person-group> (<year>2008</year>). <source>Lehninger Principles of Biochemistry</source>. <publisher-name>Macmillan</publisher-name>. </citation>
</ref>
<ref id="B95">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Ne&#x161;uta</surname>
<given-names>O.</given-names>
</name>
<name>
<surname>Bud&#x11b;&#x161;&#xed;nsk&#xfd;</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Hadravov&#xe1;</surname>
<given-names>R.</given-names>
</name>
<name>
<surname>Monincov&#xe1;</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Humpoli&#x10d;kov&#xe1;</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>&#x10c;e&#x159;ovsk&#xfd;</surname>
<given-names>V.</given-names>
</name>
</person-group> (<year>2017</year>). <article-title>How Proteases from <italic>Enterococcus faecalis</italic> Contribute to its Resistance to Short &#x3b1;-helical Antimicrobial Peptides</article-title>. <source>Pathogens Dis.</source> <volume>75</volume> (<issue>7</issue>), <fpage>ftx091</fpage>. </citation>
</ref>
<ref id="B96">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Nguyen</surname>
<given-names>L. T.</given-names>
</name>
<name>
<surname>Haney</surname>
<given-names>E. F.</given-names>
</name>
<name>
<surname>Vogel</surname>
<given-names>H. J.</given-names>
</name>
</person-group> (<year>2011</year>). <article-title>The Expanding Scope of Antimicrobial Peptide Structures and Their Modes of Action</article-title>. <source>Trends Biotechnol.</source> <volume>29</volume> (<issue>9</issue>), <fpage>464</fpage>&#x2013;<lpage>472</lpage>. <pub-id pub-id-type="doi">10.1016/j.tibtech.2011.05.001</pub-id> </citation>
</ref>
<ref id="B97">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Nomura</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Villegas</surname>
<given-names>E.</given-names>
</name>
<name>
<surname>Corzo</surname>
<given-names>G.</given-names>
</name>
</person-group> (<year>2014</year>). <article-title>Solid-state NMR Studies of Antimicrobial Peptides from Arachnid Venoms</article-title>. <source>Biomed. Spectrosc. Imaging</source> <volume>3</volume> (<issue>2</issue>), <fpage>107</fpage>&#x2013;<lpage>120</lpage>. <pub-id pub-id-type="doi">10.3233/bsi-140082</pub-id> </citation>
</ref>
<ref id="B98">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Oren</surname>
<given-names>Z.</given-names>
</name>
<name>
<surname>Shai</surname>
<given-names>Y.</given-names>
</name>
</person-group> (<year>1998</year>). <article-title>Mode of Action of Linear Amphipathic &#x3b1;-helical Antimicrobial Peptides</article-title>. <source>Biopolymers</source> <volume>47</volume> (<issue>6</issue>), <fpage>451</fpage>&#x2013;<lpage>463</lpage>. <pub-id pub-id-type="doi">10.1002/(sici)1097-0282(1998)47:6&#x3c;451::aid-bip4&#x3e;3.0.co;2-f</pub-id> </citation>
</ref>
<ref id="B99">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Ortiz</surname>
<given-names>E.</given-names>
</name>
<name>
<surname>Gurrola</surname>
<given-names>G. B.</given-names>
</name>
<name>
<surname>Schwartz</surname>
<given-names>E. F.</given-names>
</name>
<name>
<surname>Possani</surname>
<given-names>L. D.</given-names>
</name>
</person-group> (<year>2015</year>). <article-title>Scorpion Venom Components as Potential Candidates for Drug Development</article-title>. <source>Toxicon</source> <volume>93</volume>, <fpage>125</fpage>&#x2013;<lpage>135</lpage>. <pub-id pub-id-type="doi">10.1016/j.toxicon.2014.11.233</pub-id> </citation>
</ref>
<ref id="B100">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Parachin</surname>
<given-names>N. S.</given-names>
</name>
<name>
<surname>Franco</surname>
<given-names>O. L.</given-names>
</name>
</person-group> (<year>2014</year>). <article-title>New Edge of Antibiotic Development: Antimicrobial Peptides and Corresponding Resistance</article-title>. <source>Front. Microbiol.</source> <volume>5</volume>, <fpage>147</fpage>. <pub-id pub-id-type="doi">10.3389/fmicb.2014.00147</pub-id> </citation>
</ref>
<ref id="B101">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Parente</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Daniele-Silva</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Furtado</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Melo</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Lacerda</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Queiroz</surname>
<given-names>M.</given-names>
</name>
<etal/>
</person-group> (<year>2018</year>). <article-title>Analogs of the Scorpion Venom Peptide Stigmurin: Structural Assessment, Toxicity, and Increased Antimicrobial Activity</article-title>. <source>Toxins</source> <volume>10</volume> (<issue>4</issue>), <fpage>161</fpage>. <pub-id pub-id-type="doi">10.3390/toxins10040161</pub-id> </citation>
</ref>
<ref id="B102">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Pedron</surname>
<given-names>C. N.</given-names>
</name>
<name>
<surname>Torres</surname>
<given-names>M. D. T.</given-names>
</name>
<name>
<surname>Lima</surname>
<given-names>J. A. d. S.</given-names>
</name>
<name>
<surname>Silva</surname>
<given-names>P. I.</given-names>
</name>
<name>
<surname>Silva</surname>
<given-names>F. D.</given-names>
</name>
<name>
<surname>Oliveira</surname>
<given-names>V. X.</given-names>
</name>
</person-group> (<year>2017</year>). <article-title>Novel Designed VmCT1 Analogs with Increased Antimicrobial Activity</article-title>. <source>Eur. J. Med. Chem.</source> <volume>126</volume>, <fpage>456</fpage>&#x2013;<lpage>463</lpage>. <pub-id pub-id-type="doi">10.1016/j.ejmech.2016.11.040</pub-id> </citation>
</ref>
<ref id="B103">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Peschel</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Sahl</surname>
<given-names>H.-G.</given-names>
</name>
</person-group> (<year>2006</year>). <article-title>The Co-evolution of Host Cationic Antimicrobial Peptides and Microbial Resistance</article-title>. <source>Nat. Rev. Microbiol.</source> <volume>4</volume> (<issue>7</issue>), <fpage>529</fpage>&#x2013;<lpage>536</lpage>. <pub-id pub-id-type="doi">10.1038/nrmicro1441</pub-id> </citation>
</ref>
<ref id="B104">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Peters</surname>
<given-names>B. M.</given-names>
</name>
<name>
<surname>Shirtliff</surname>
<given-names>M. E.</given-names>
</name>
<name>
<surname>Jabra-Rizk</surname>
<given-names>M. A.</given-names>
</name>
</person-group> (<year>2010</year>). <article-title>Antimicrobial Peptides: Primeval Molecules or Future Drugs?</article-title> <source>PLoS Pathog.</source> <volume>6</volume> (<issue>10</issue>), <fpage>e1001067</fpage>. <pub-id pub-id-type="doi">10.1371/journal.ppat.1001067</pub-id> </citation>
</ref>
<ref id="B105">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Pettersen</surname>
<given-names>E. F.</given-names>
</name>
<name>
<surname>Goddard</surname>
<given-names>T. D.</given-names>
</name>
<name>
<surname>Huang</surname>
<given-names>C. C.</given-names>
</name>
<name>
<surname>Couch</surname>
<given-names>G. S.</given-names>
</name>
<name>
<surname>Greenblatt</surname>
<given-names>D. M.</given-names>
</name>
<name>
<surname>Meng</surname>
<given-names>E. C.</given-names>
</name>
<etal/>
</person-group> (<year>2004</year>). <article-title>UCSF Chimera?A Visualization System for Exploratory Research and Analysis</article-title>. <source>J. Comput. Chem.</source> <volume>25</volume> (<issue>13</issue>), <fpage>1605</fpage>&#x2013;<lpage>1612</lpage>. <pub-id pub-id-type="doi">10.1002/jcc.20084</pub-id> </citation>
</ref>
<ref id="B106">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Riahifard</surname>
<given-names>N.</given-names>
</name>
<name>
<surname>Mozaffari</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Aldakhil</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>Nunez</surname>
<given-names>F.</given-names>
</name>
<name>
<surname>Alshammari</surname>
<given-names>Q.</given-names>
</name>
<name>
<surname>Alshammari</surname>
<given-names>S.</given-names>
</name>
<etal/>
</person-group> (<year>2018</year>). <article-title>Design, Synthesis, and Evaluation of Amphiphilic Cyclic and Linear Peptides Composed of Hydrophobic and Positively-Charged Amino Acids as Antibacterial Agents</article-title>. <source>Molecules</source> <volume>23</volume> (<issue>10</issue>), <fpage>2722</fpage>. <pub-id pub-id-type="doi">10.3390/molecules23102722</pub-id> </citation>
</ref>
<ref id="B107">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Rodr&#xed;guez</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Villegas</surname>
<given-names>E.</given-names>
</name>
<name>
<surname>Montoya-Rosales</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Rivas-Santiago</surname>
<given-names>B.</given-names>
</name>
<name>
<surname>Corzo</surname>
<given-names>G.</given-names>
</name>
</person-group> (<year>2014</year>). <article-title>Characterization of Antibacterial and Hemolytic Activity of Synthetic Pandinin 2 Variants and Their Inhibition against <italic>Mycobacterium tuberculosis</italic>
</article-title>. <source>PloS one</source> <volume>9</volume> (<issue>7</issue>), <fpage>e101742</fpage>. <pub-id pub-id-type="doi">10.1371/journal.pone.0101742</pub-id> </citation>
</ref>
<ref id="B108">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Rotem</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Mor</surname>
<given-names>A.</given-names>
</name>
</person-group> (<year>2009</year>). <article-title>Antimicrobial Peptide Mimics for Improved Therapeutic Properties</article-title>. <source>Biochimica Biophysica Acta (BBA) - Biomembr.</source> <volume>1788</volume> (<issue>8</issue>), <fpage>1582</fpage>&#x2013;<lpage>1592</lpage>. <pub-id pub-id-type="doi">10.1016/j.bbamem.2008.10.020</pub-id> </citation>
</ref>
<ref id="B109">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>S&#xe1;nchez-V&#xe1;squez</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Silva-Sanchez</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Jim&#xe9;nez-Vargas</surname>
<given-names>J. M.</given-names>
</name>
<name>
<surname>Rodr&#xed;guez-Romero</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Mu&#xf1;oz-Garay</surname>
<given-names>C.</given-names>
</name>
<name>
<surname>Rodr&#xed;guez</surname>
<given-names>M. C.</given-names>
</name>
<etal/>
</person-group> (<year>2013</year>). <article-title>Enhanced Antimicrobial Activity of Novel Synthetic Peptides Derived from Vejovine and Hadrurin</article-title>. <source>Biochimica Biophysica Acta (BBA) - General Subj.</source> <volume>1830</volume> (<issue>6</issue>), <fpage>3427</fpage>&#x2013;<lpage>3436</lpage>. <pub-id pub-id-type="doi">10.1016/j.bbagen.2013.01.028</pub-id> </citation>
</ref>
<ref id="B110">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Scott</surname>
<given-names>M. G.</given-names>
</name>
<name>
<surname>Gold</surname>
<given-names>M. R.</given-names>
</name>
<name>
<surname>Hancock</surname>
<given-names>R. E. W.</given-names>
</name>
</person-group> (<year>1999</year>). <article-title>Interaction of Cationic Peptides with Lipoteichoic Acid and Gram-Positive Bacteria</article-title>. <source>Infect. Immun.</source> <volume>67</volume> (<issue>12</issue>), <fpage>6445</fpage>&#x2013;<lpage>6453</lpage>. <pub-id pub-id-type="doi">10.1128/iai.67.12.6445-6453.1999</pub-id> </citation>
</ref>
<ref id="B111">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Segrest</surname>
<given-names>J. P.</given-names>
</name>
<name>
<surname>De Loof</surname>
<given-names>H.</given-names>
</name>
<name>
<surname>Dohlman</surname>
<given-names>J. G.</given-names>
</name>
<name>
<surname>Brouillette</surname>
<given-names>C. G.</given-names>
</name>
<name>
<surname>Anantharamaiah</surname>
<given-names>G. M.</given-names>
</name>
</person-group> (<year>1990</year>). <article-title>Amphipathic Helix Motif: Classes and Properties</article-title>. <source>Proteins</source> <volume>8</volume> (<issue>2</issue>), <fpage>103</fpage>&#x2013;<lpage>117</lpage>. <pub-id pub-id-type="doi">10.1002/prot.340080202</pub-id> </citation>
</ref>
<ref id="B112">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Seyfi</surname>
<given-names>R.</given-names>
</name>
<name>
<surname>Kahaki</surname>
<given-names>F. A.</given-names>
</name>
<name>
<surname>Ebrahimi</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>Montazersaheb</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Eyvazi</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Babaeipour</surname>
<given-names>V.</given-names>
</name>
<etal/>
</person-group> (<year>2020</year>). <article-title>Antimicrobial Peptides (AMPs): Roles, Functions and Mechanism of Action</article-title>. <source>Int. J. Pept. Res. Ther.</source> <volume>26</volume> (<issue>3</issue>), <fpage>1451</fpage>&#x2013;<lpage>1463</lpage>. <pub-id pub-id-type="doi">10.1007/s10989-019-09946-9</pub-id> </citation>
</ref>
<ref id="B113">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Sfor&#xe7;a</surname>
<given-names>M. L.</given-names>
</name>
<name>
<surname>Oyama</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Canduri</surname>
<given-names>F.</given-names>
</name>
<name>
<surname>Lorenzi</surname>
<given-names>C. C. B.</given-names>
</name>
<name>
<surname>Pertinhez</surname>
<given-names>T. A.</given-names>
</name>
<name>
<surname>Konno</surname>
<given-names>K.</given-names>
</name>
<etal/>
</person-group> (<year>2004</year>). <article-title>How C-Terminal Carboxyamidation Alters the Biological Activity of Peptides from the Venom of the Eumenine Solitary Wasp</article-title>. <source>Biochemistry</source> <volume>43</volume> (<issue>19</issue>), <fpage>5608</fpage>&#x2013;<lpage>5617</lpage>. <pub-id pub-id-type="doi">10.1021/bi0360915</pub-id> </citation>
</ref>
<ref id="B114">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Shahzadi</surname>
<given-names>S. K.</given-names>
</name>
<name>
<surname>Karuvantevida</surname>
<given-names>N.</given-names>
</name>
<name>
<surname>Banerjee</surname>
<given-names>Y.</given-names>
</name>
</person-group> (<year>2021</year>). <article-title>A Venomics Approach to the Identification and Characterization of Bioactive Peptides from Animal Venoms for Colorectal Cancer Therapy: Protocol for a Proof-Of-Concept Study</article-title>. <source>JMIR Res. Protoc.</source> <volume>10</volume> (<issue>12</issue>), <fpage>e31128</fpage>. <pub-id pub-id-type="doi">10.2196/31128</pub-id> </citation>
</ref>
<ref id="B115">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Shai</surname>
<given-names>Y.</given-names>
</name>
</person-group> (<year>1999</year>). <article-title>Mechanism of the Binding, Insertion and Destabilization of Phospholipid Bilayer Membranes by Alpha-Helical Antimicrobial and Cell Non-selective Membrane-Lytic Peptides</article-title>. <source>Biochim. Biophys. Acta</source> <volume>1462</volume> (<issue>1-2</issue>), <fpage>55</fpage>&#x2013;<lpage>70</lpage>. <pub-id pub-id-type="doi">10.1016/s0005-2736(99)00200-x</pub-id> </citation>
</ref>
<ref id="B116">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Shi</surname>
<given-names>W.</given-names>
</name>
<name>
<surname>He</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Zeng</surname>
<given-names>X.-C.</given-names>
</name>
<name>
<surname>Wu</surname>
<given-names>W.</given-names>
</name>
<name>
<surname>Chen</surname>
<given-names>X.</given-names>
</name>
</person-group> (<year>2018</year>). <article-title>Inhibitory Effect of an Acidic Peptide on the Activity of an Antimicrobial Peptide from the Scorpion Mesobuthus Martensii Karsch</article-title>. <source>Molecules</source> <volume>23</volume> (<issue>12</issue>), <fpage>3314</fpage>. <pub-id pub-id-type="doi">10.3390/molecules23123314</pub-id> </citation>
</ref>
<ref id="B117">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Soliman</surname>
<given-names>B. A.</given-names>
</name>
<name>
<surname>Shoukry</surname>
<given-names>N. M.</given-names>
</name>
<name>
<surname>Mohallal</surname>
<given-names>M. E.</given-names>
</name>
<name>
<surname>Fetaih</surname>
<given-names>H. A. W.</given-names>
</name>
<name>
<surname>khaled</surname>
<given-names>H. S.</given-names>
</name>
</person-group> (<year>2013</year>). <article-title>Fine Structure of the Stinger, Histology and Histochemistry of the Venom Gland in the Scorpion Androctonus Amoreuxi (Buthidae)</article-title>. <source>J. Basic &#x26; Appl. Zoology</source> <volume>66</volume> (<issue>2</issue>), <fpage>41</fpage>&#x2013;<lpage>46</lpage>. <pub-id pub-id-type="doi">10.1016/j.jobaz.2013.03.001</pub-id> </citation>
</ref>
<ref id="B118">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Solstad</surname>
<given-names>R. G.</given-names>
</name>
<name>
<surname>Johansen</surname>
<given-names>C.</given-names>
</name>
<name>
<surname>Stensv&#xe5;g</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Str&#xf8;m</surname>
<given-names>M. B.</given-names>
</name>
<name>
<surname>Haug</surname>
<given-names>T.</given-names>
</name>
</person-group> (<year>2020</year>). <article-title>Structure-activity Relationship Studies of Shortened Analogues of the Antimicrobial Peptide EeCentrocin 1 from the Sea Urchin Echinus Esculentus</article-title>. <source>J. Pept. Sci.</source> <volume>26</volume> (<issue>2</issue>), <fpage>e3233</fpage>. <pub-id pub-id-type="doi">10.1002/psc.3233</pub-id> </citation>
</ref>
<ref id="B119">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Strandberg</surname>
<given-names>E.</given-names>
</name>
<name>
<surname>Tiltak</surname>
<given-names>D.</given-names>
</name>
<name>
<surname>Ieronimo</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Kanithasen</surname>
<given-names>N.</given-names>
</name>
<name>
<surname>Wadhwani</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Ulrich</surname>
<given-names>A. S.</given-names>
</name>
</person-group> (<year>2007</year>). <article-title>Influence of C-Terminal Amidation on the Antimicrobial and Hemolytic Activities of Cationic &#x3b1;-helical Peptides</article-title>. <source>Pure Appl. Chem.</source> <volume>79</volume> (<issue>4</issue>), <fpage>717</fpage>&#x2013;<lpage>728</lpage>. <pub-id pub-id-type="doi">10.1351/pac200779040717</pub-id> </citation>
</ref>
<ref id="B120">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Tawfik</surname>
<given-names>M. M.</given-names>
</name>
<name>
<surname>Bertelsen</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Abdel-Rahman</surname>
<given-names>M. A.</given-names>
</name>
<name>
<surname>Strong</surname>
<given-names>P. N.</given-names>
</name>
<name>
<surname>Miller</surname>
<given-names>K.</given-names>
</name>
</person-group> (<year>2021</year>). <article-title>Scorpion Venom Antimicrobial Peptides Induce Siderophore Biosynthesis and Oxidative Stress Responses in <italic>Escherichia coli</italic>
</article-title>. <source>Msphere</source> <volume>6</volume> (<issue>3</issue>), <fpage>e00267</fpage>&#x2013;<lpage>00221</lpage>. <pub-id pub-id-type="doi">10.1128/mSphere.00267-21</pub-id> </citation>
</ref>
<ref id="B121">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Toke</surname>
<given-names>O.</given-names>
</name>
</person-group> (<year>2005</year>). <article-title>Antimicrobial Peptides: New Candidates in the Fight against Bacterial Infections</article-title>. <source>Biopolymers</source> <volume>80</volume> (<issue>6</issue>), <fpage>717</fpage>&#x2013;<lpage>735</lpage>. <pub-id pub-id-type="doi">10.1002/bip.20286</pub-id> </citation>
</ref>
<ref id="B122">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Torrent</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Pulido</surname>
<given-names>D.</given-names>
</name>
<name>
<surname>Rivas</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Andreu</surname>
<given-names>D.</given-names>
</name>
</person-group> (<year>2012</year>). <article-title>Antimicrobial Peptide Action on Parasites</article-title>. <source>Cdt</source> <volume>13</volume> (<issue>9</issue>), <fpage>1138</fpage>&#x2013;<lpage>1147</lpage>. <pub-id pub-id-type="doi">10.2174/138945012802002393</pub-id> </citation>
</ref>
<ref id="B123">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Torres-Larios</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Gurrola</surname>
<given-names>G. B.</given-names>
</name>
<name>
<surname>Zamudio</surname>
<given-names>F. Z.</given-names>
</name>
<name>
<surname>Possani</surname>
<given-names>L. D.</given-names>
</name>
</person-group> (<year>2000</year>). <article-title>Hadrurin, a New Antimicrobial Peptide from the Venom of the Scorpion Hadrurus Aztecus</article-title>. <source>Eur. J. Biochem.</source> <volume>267</volume> (<issue>16</issue>), <fpage>5023</fpage>&#x2013;<lpage>5031</lpage>. <pub-id pub-id-type="doi">10.1046/j.1432-1327.2000.01556.x</pub-id> </citation>
</ref>
<ref id="B124">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Tossi</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Sandri</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Giangaspero</surname>
<given-names>A.</given-names>
</name>
</person-group> (<year>2000</year>). <article-title>Amphipathic, &#x3b1;-helical Antimicrobial Peptides</article-title>. <source>Biopolymers</source> <volume>55</volume> (<issue>1</issue>), <fpage>4</fpage>&#x2013;<lpage>30</lpage>. <pub-id pub-id-type="doi">10.1002/1097-0282(2000)55:1&#x3c;4::aid-bip30&#x3e;3.0.co;2-m</pub-id> </citation>
</ref>
<ref id="B125">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Tripathi</surname>
<given-names>J. K.</given-names>
</name>
<name>
<surname>Kathuria</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Kumar</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Mitra</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Ghosh</surname>
<given-names>J. K.</given-names>
</name>
</person-group> (<year>2015</year>). <article-title>An Unprecedented Alteration in Mode of Action of IsCT Resulting its Translocation into Bacterial Cytoplasm and Inhibition of Macromolecular Syntheses</article-title>. <source>Sci. Rep.</source> <volume>5</volume>, <fpage>9127</fpage>. <pub-id pub-id-type="doi">10.1038/srep09127</pub-id> </citation>
</ref>
<ref id="B126">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Tytler</surname>
<given-names>E. M.</given-names>
</name>
<name>
<surname>Segrest</surname>
<given-names>J. P.</given-names>
</name>
<name>
<surname>Epand</surname>
<given-names>R. M.</given-names>
</name>
<name>
<surname>Nie</surname>
<given-names>S. Q.</given-names>
</name>
<name>
<surname>Epand</surname>
<given-names>R. F.</given-names>
</name>
<name>
<surname>Mishra</surname>
<given-names>V. K.</given-names>
</name>
<etal/>
</person-group> (<year>1993</year>). <article-title>Reciprocal Effects of Apolipoprotein and Lytic Peptide Analogs on Membranes. Cross-Sectional Molecular Shapes of Amphipathic Alpha Helixes Control Membrane Stability</article-title>. <source>J. Biol. Chem.</source> <volume>268</volume> (<issue>29</issue>), <fpage>22112</fpage>&#x2013;<lpage>22118</lpage>. <pub-id pub-id-type="doi">10.1016/s0021-9258(20)80655-3</pub-id> </citation>
</ref>
<ref id="B127">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Uawonggul</surname>
<given-names>N.</given-names>
</name>
<name>
<surname>Thammasirirak</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Chaveerach</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Arkaravichien</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>Bunyatratchata</surname>
<given-names>W.</given-names>
</name>
<name>
<surname>Ruangjirachuporn</surname>
<given-names>W.</given-names>
</name>
<etal/>
</person-group> (<year>2007</year>). <article-title>Purification and Characterization of Heteroscorpine-1 (HS-1) Toxin from Heterometrus Laoticus Scorpion Venom</article-title>. <source>Toxicon</source> <volume>49</volume> (<issue>1</issue>), <fpage>19</fpage>&#x2013;<lpage>29</lpage>. <pub-id pub-id-type="doi">10.1016/j.toxicon.2006.09.003</pub-id> </citation>
</ref>
<ref id="B128">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Uggerh&#xf8;j</surname>
<given-names>L. E.</given-names>
</name>
<name>
<surname>Poulsen</surname>
<given-names>T. J.</given-names>
</name>
<name>
<surname>Munk</surname>
<given-names>J. K.</given-names>
</name>
<name>
<surname>Fredborg</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Sondergaard</surname>
<given-names>T. E.</given-names>
</name>
<name>
<surname>Frimodt-Moller</surname>
<given-names>N.</given-names>
</name>
<etal/>
</person-group> (<year>2015</year>). <article-title>Rational Design of Alpha-Helical Antimicrobial Peptides: Do&#x27;s and Don&#x27;ts</article-title>. <source>ChemBioChem</source> <volume>16</volume> (<issue>2</issue>), <fpage>242</fpage>&#x2013;<lpage>253</lpage>. <pub-id pub-id-type="doi">10.1002/cbic.201402581</pub-id> </citation>
</ref>
<ref id="B129">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Wallace</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Daman</surname>
<given-names>O. A.</given-names>
</name>
<name>
<surname>Harris</surname>
<given-names>F.</given-names>
</name>
<name>
<surname>Phoenix</surname>
<given-names>D. A.</given-names>
</name>
</person-group> (<year>2004</year>). <article-title>Investigation of Hydrophobic Moment and Hydrophobicity Properties for Transmembrane Alpha-Helices</article-title>. <source>Theor. Biol. Med. Model</source> <volume>1</volume> (<issue>1</issue>), <fpage>5</fpage>&#x2013;<lpage>11</lpage>. <pub-id pub-id-type="doi">10.1186/1742-4682-1-5</pub-id> </citation>
</ref>
<ref id="B130">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Wang</surname>
<given-names>G.</given-names>
</name>
<name>
<surname>Li</surname>
<given-names>X.</given-names>
</name>
<name>
<surname>Wang</surname>
<given-names>Z.</given-names>
</name>
</person-group> (<year>2008</year>). <article-title>APD2: the Updated Antimicrobial Peptide Database and its Application in Peptide Design</article-title>. <source>Nucleic acids Res.</source> <volume>37</volume> (<issue>Suppl. l_1</issue>), <fpage>D933</fpage>&#x2013;<lpage>D937</lpage>. <pub-id pub-id-type="doi">10.1093/nar/gkn823</pub-id> </citation>
</ref>
<ref id="B131">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Wang</surname>
<given-names>G.</given-names>
</name>
<name>
<surname>Li</surname>
<given-names>X.</given-names>
</name>
<name>
<surname>Wang</surname>
<given-names>Z.</given-names>
</name>
</person-group> (<year>2016</year>). <article-title>APD3: the Antimicrobial Peptide Database as a Tool for Research and Education</article-title>. <source>Nucleic Acids Res.</source> <volume>44</volume> (<issue>D1</issue>), <fpage>D1087</fpage>&#x2013;<lpage>D1093</lpage>. <pub-id pub-id-type="doi">10.1093/nar/gkv1278</pub-id> </citation>
</ref>
<ref id="B132">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Wang</surname>
<given-names>X.-y.</given-names>
</name>
<name>
<surname>Li</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>Johannes</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Xu</surname>
<given-names>J.-p.</given-names>
</name>
<name>
<surname>Sun</surname>
<given-names>X.</given-names>
</name>
<name>
<surname>Qin</surname>
<given-names>S.</given-names>
</name>
<etal/>
</person-group> (<year>2019</year>). <article-title>The Regulation of Crecropin-A and Gloverin 2 by the Silkworm Toll-like Gene 18 Wheeler in Immune Response</article-title>. <source>J. Invertebr. pathology</source> <volume>164</volume>, <fpage>49</fpage>&#x2013;<lpage>58</lpage>. <pub-id pub-id-type="doi">10.1016/j.jip.2019.04.006</pub-id> </citation>
</ref>
<ref id="B133">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Wieprecht</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>Dathe</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Beyermann</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Krause</surname>
<given-names>E.</given-names>
</name>
<name>
<surname>Maloy</surname>
<given-names>W. L.</given-names>
</name>
<name>
<surname>MacDonald</surname>
<given-names>D. L.</given-names>
</name>
<etal/>
</person-group> (<year>1997</year>). <article-title>Peptide Hydrophobicity Controls the Activity and Selectivity of Magainin 2 Amide in Interaction with Membranes</article-title>. <source>Biochemistry</source> <volume>36</volume> (<issue>20</issue>), <fpage>6124</fpage>&#x2013;<lpage>6132</lpage>. <pub-id pub-id-type="doi">10.1021/bi9619987</pub-id> </citation>
</ref>
<ref id="B134">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Wiradharma</surname>
<given-names>N.</given-names>
</name>
<name>
<surname>Khoe</surname>
<given-names>U.</given-names>
</name>
<name>
<surname>Hauser</surname>
<given-names>C. A. E.</given-names>
</name>
<name>
<surname>Seow</surname>
<given-names>S. V.</given-names>
</name>
<name>
<surname>Zhang</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Yang</surname>
<given-names>Y.-Y.</given-names>
</name>
</person-group> (<year>2011</year>). <article-title>Synthetic Cationic Amphiphilic &#x3b1;-helical Peptides as Antimicrobial Agents</article-title>. <source>Biomaterials</source> <volume>32</volume> (<issue>8</issue>), <fpage>2204</fpage>&#x2013;<lpage>2212</lpage>. <pub-id pub-id-type="doi">10.1016/j.biomaterials.2010.11.054</pub-id> </citation>
</ref>
<ref id="B135">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Wu</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Maier</surname>
<given-names>E.</given-names>
</name>
<name>
<surname>Benz</surname>
<given-names>R.</given-names>
</name>
<name>
<surname>Hancock</surname>
<given-names>R. E. W.</given-names>
</name>
</person-group> (<year>1999</year>). <article-title>Mechanism of Interaction of Different Classes of Cationic Antimicrobial Peptides with Planar Bilayers and with the Cytoplasmic Membrane of <italic>Escherichia coli</italic>
</article-title>. <source>Biochemistry</source> <volume>38</volume> (<issue>22</issue>), <fpage>7235</fpage>&#x2013;<lpage>7242</lpage>. <pub-id pub-id-type="doi">10.1021/bi9826299</pub-id> </citation>
</ref>
<ref id="B136">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Wu</surname>
<given-names>Q.</given-names>
</name>
<name>
<surname>Pato&#x10d;ka</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Ku&#x10d;a</surname>
<given-names>K.</given-names>
</name>
</person-group> (<year>2018</year>). <article-title>Insect Antimicrobial Peptides, a Mini Review</article-title>. <source>Toxins</source> <volume>10</volume> (<issue>11</issue>), <fpage>461</fpage>. <pub-id pub-id-type="doi">10.3390/toxins10110461</pub-id> </citation>
</ref>
<ref id="B137">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Wu</surname>
<given-names>R.</given-names>
</name>
<name>
<surname>Patocka</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Nepovimova</surname>
<given-names>E.</given-names>
</name>
<name>
<surname>Oleksak</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Valis</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Wu</surname>
<given-names>W.</given-names>
</name>
<etal/>
</person-group> (<year>2021</year>). <article-title>Marine Invertebrate Peptides: Antimicrobial Peptides</article-title>. <source>Front. Microbiol.</source> <volume>12</volume>. <pub-id pub-id-type="doi">10.3389/fmicb.2021.785085</pub-id> </citation>
</ref>
<ref id="B138">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Wu</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Nie</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Zeng</surname>
<given-names>X.-C.</given-names>
</name>
<name>
<surname>Cao</surname>
<given-names>H.</given-names>
</name>
<name>
<surname>Zhang</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Zhou</surname>
<given-names>L.</given-names>
</name>
<etal/>
</person-group> (<year>2014a</year>). <article-title>Genomic and Functional Characterization of Three New Venom Peptides from the Scorpion Heterometrus Spinifer</article-title>. <source>Peptides</source> <volume>53</volume>, <fpage>30</fpage>&#x2013;<lpage>41</lpage>. <pub-id pub-id-type="doi">10.1016/j.peptides.2013.12.012</pub-id> </citation>
</ref>
<ref id="B139">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Wu</surname>
<given-names>X.</given-names>
</name>
<name>
<surname>Wang</surname>
<given-names>Z.</given-names>
</name>
<name>
<surname>Li</surname>
<given-names>X.</given-names>
</name>
<name>
<surname>Fan</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>He</surname>
<given-names>G.</given-names>
</name>
<name>
<surname>Wan</surname>
<given-names>Y.</given-names>
</name>
<etal/>
</person-group> (<year>2014b</year>). <article-title>
<italic>In Vitro</italic> and <italic>In Vivo</italic> Activity of Antimicrobial Peptides Developed Using an Amino Acid-Based Activity Prediction Method</article-title>, <source>Antimicrob. agents Chemother</source>. <volume>58</volume>. <fpage>5342</fpage>&#x2013;<lpage>5349</lpage>. <pub-id pub-id-type="doi">10.1128/AAC.02823-14</pub-id> </citation>
</ref>
<ref id="B140">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Xie</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Zhao</surname>
<given-names>Q.</given-names>
</name>
<name>
<surname>Li</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Yan</surname>
<given-names>Z.</given-names>
</name>
<name>
<surname>Li</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Li</surname>
<given-names>Y.</given-names>
</name>
<etal/>
</person-group> (<year>2017</year>). <article-title>Novel Antimicrobial Peptide CPF-C1 Analogs with Superior Stabilities and Activities against Multidrug-Resistant Bacteria</article-title>. <source>Chem. Biol. Drug Des.</source> <volume>90</volume> (<issue>5</issue>), <fpage>690</fpage>&#x2013;<lpage>702</lpage>. <pub-id pub-id-type="doi">10.1111/cbdd.12988</pub-id> </citation>
</ref>
<ref id="B141">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Yan</surname>
<given-names>H.</given-names>
</name>
<name>
<surname>Li</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Sun</surname>
<given-names>X.</given-names>
</name>
<name>
<surname>Mi</surname>
<given-names>H.</given-names>
</name>
<name>
<surname>He</surname>
<given-names>B.</given-names>
</name>
</person-group> (<year>2003</year>). <article-title>Individual Substitution Analogs of Mel(12-26), Melittin&#x27;s C-Terminal 15-residue Peptide: Their Antimicrobial and Hemolytic Actions</article-title>. <source>FEBS Lett.</source> <volume>554</volume> (<issue>1-2</issue>), <fpage>100</fpage>&#x2013;<lpage>104</lpage>. <pub-id pub-id-type="doi">10.1016/s0014-5793(03)01113-x</pub-id> </citation>
</ref>
<ref id="B142">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Yang</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Harroun</surname>
<given-names>T. A.</given-names>
</name>
<name>
<surname>Weiss</surname>
<given-names>T. M.</given-names>
</name>
<name>
<surname>Ding</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Huang</surname>
<given-names>H. W.</given-names>
</name>
</person-group> (<year>2001</year>). <article-title>Barrel-stave Model or Toroidal Model? A Case Study on Melittin Pores</article-title>. <source>Biophysical J.</source> <volume>81</volume> (<issue>3</issue>), <fpage>1475</fpage>&#x2013;<lpage>1485</lpage>. <pub-id pub-id-type="doi">10.1016/s0006-3495(01)75802-x</pub-id> </citation>
</ref>
<ref id="B143">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Yeaman</surname>
<given-names>M. R.</given-names>
</name>
<name>
<surname>Yount</surname>
<given-names>N. Y.</given-names>
</name>
</person-group> (<year>2003</year>). <article-title>Mechanisms of Antimicrobial Peptide Action and Resistance</article-title>. <source>Pharmacol. Rev.</source> <volume>55</volume> (<issue>1</issue>), <fpage>27</fpage>&#x2013;<lpage>55</lpage>. <pub-id pub-id-type="doi">10.1124/pr.55.1.2</pub-id> </citation>
</ref>
<ref id="B144">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Zeng</surname>
<given-names>X.-C.</given-names>
</name>
<name>
<surname>Wang</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Nie</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Zhang</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Luo</surname>
<given-names>X.</given-names>
</name>
</person-group> (<year>2012</year>). <article-title>Characterization of BmKbpp, a Multifunctional Peptide from the Chinese Scorpion Mesobuthus Martensii Karsch: Gaining Insight into a New Mechanism for the Functional Diversification of Scorpion Venom Peptides</article-title>. <source>Peptides</source> <volume>33</volume> (<issue>1</issue>), <fpage>44</fpage>&#x2013;<lpage>51</lpage>. <pub-id pub-id-type="doi">10.1016/j.peptides.2011.11.012</pub-id> </citation>
</ref>
<ref id="B145">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Zeng</surname>
<given-names>Z, X.-C.</given-names>
</name>
<name>
<surname>Zhou</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Shi</surname>
<given-names>W.</given-names>
</name>
<name>
<surname>Luo</surname>
<given-names>X.</given-names>
</name>
<name>
<surname>Zhang</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Nie</surname>
<given-names>Y.</given-names>
</name>
<etal/>
</person-group> (<year>2013</year>). <article-title>Three New Antimicrobial Peptides from the Scorpion Pandinus Imperator</article-title>. <source>Peptides</source> <volume>45</volume>, <fpage>28</fpage>&#x2013;<lpage>34</lpage>. <pub-id pub-id-type="doi">10.1016/j.peptides.2013.03.026</pub-id> </citation>
</ref>
<ref id="B146">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Zhang</surname>
<given-names>S.-K.</given-names>
</name>
<name>
<surname>Song</surname>
<given-names>J.-w.</given-names>
</name>
<name>
<surname>Gong</surname>
<given-names>F.</given-names>
</name>
<name>
<surname>Li</surname>
<given-names>S.-B.</given-names>
</name>
<name>
<surname>Chang</surname>
<given-names>H.-Y.</given-names>
</name>
<name>
<surname>Xie</surname>
<given-names>H.-M.</given-names>
</name>
<etal/>
</person-group> (<year>2016</year>). <article-title>Design of an &#x3b1;-helical Antimicrobial Peptide with Improved Cell-Selective and Potent Anti-biofilm Activity</article-title>. <source>Sci. Rep.</source> <volume>6</volume>, <fpage>27394</fpage>. <pub-id pub-id-type="doi">10.1038/srep27394</pub-id> </citation>
</ref>
<ref id="B147">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Zhao</surname>
<given-names>Z.</given-names>
</name>
<name>
<surname>Ma</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Dai</surname>
<given-names>C.</given-names>
</name>
<name>
<surname>Zhao</surname>
<given-names>R.</given-names>
</name>
<name>
<surname>Li</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Wu</surname>
<given-names>Y.</given-names>
</name>
<etal/>
</person-group> (<year>2009</year>). <article-title>Imcroporin, a New Cationic Antimicrobial Peptide from the Venom of the Scorpion Isometrus Maculates</article-title>. <source>Antimicrob. Agents Chemother.</source> <volume>53</volume> (<issue>8</issue>), <fpage>3472</fpage>&#x2013;<lpage>3477</lpage>. <pub-id pub-id-type="doi">10.1128/aac.01436-08</pub-id> </citation>
</ref>
<ref id="B148">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Zou</surname>
<given-names>R.</given-names>
</name>
<name>
<surname>Zhu</surname>
<given-names>X.</given-names>
</name>
<name>
<surname>Tu</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Wu</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Landry</surname>
<given-names>M. P.</given-names>
</name>
</person-group> (<year>2018</year>). <article-title>Activity of Antimicrobial Peptide Aggregates Decreases with Increased Cell Membrane Embedding Free Energy Cost</article-title>. <source>Biochemistry</source> <volume>57</volume> (<issue>18</issue>), <fpage>2606</fpage>&#x2013;<lpage>2610</lpage>. <pub-id pub-id-type="doi">10.1021/acs.biochem.8b00052</pub-id> </citation>
</ref>
</ref-list>
</back>
</article>