<?xml version="1.0" encoding="UTF-8"?>
<!DOCTYPE article PUBLIC "-//NLM//DTD Journal Publishing DTD v2.3 20070202//EN" "journalpublishing.dtd">
<article article-type="research-article" dtd-version="2.3" xml:lang="EN" xmlns:mml="http://www.w3.org/1998/Math/MathML" xmlns:xlink="http://www.w3.org/1999/xlink">
<front>
<journal-meta>
<journal-id journal-id-type="publisher-id">Front. Mol. Biosci.</journal-id>
<journal-title>Frontiers in Molecular Biosciences</journal-title>
<abbrev-journal-title abbrev-type="pubmed">Front. Mol. Biosci.</abbrev-journal-title>
<issn pub-type="epub">2296-889X</issn>
<publisher>
<publisher-name>Frontiers Media S.A.</publisher-name>
</publisher>
</journal-meta>
<article-meta>
<article-id pub-id-type="publisher-id">784419</article-id>
<article-id pub-id-type="doi">10.3389/fmolb.2022.784419</article-id>
<article-categories>
<subj-group subj-group-type="heading">
<subject>Molecular Biosciences</subject>
<subj-group>
<subject>Original Research</subject>
</subj-group>
</subj-group>
</article-categories>
<title-group>
<article-title>Integrating Venom Peptide Libraries Into a Phylogenetic and Broader Biological Framework</article-title>
<alt-title alt-title-type="left-running-head">Chase et&#x20;al.</alt-title>
<alt-title alt-title-type="right-running-head">Turris and Purpuraturris Venom Peptides</alt-title>
</title-group>
<contrib-group>
<contrib contrib-type="author">
<name>
<surname>Chase</surname>
<given-names>Kevin</given-names>
</name>
<xref ref-type="aff" rid="aff1">
<sup>1</sup>
</xref>
<xref ref-type="fn" rid="fn1">
<sup>&#x2020;</sup>
</xref>
<uri xlink:href="https://loop.frontiersin.org/people/1488365/overview"/>
</contrib>
<contrib contrib-type="author" corresp="yes">
<name>
<surname>Watkins</surname>
<given-names>Maren</given-names>
</name>
<xref ref-type="aff" rid="aff1">
<sup>1</sup>
</xref>
<xref ref-type="corresp" rid="c001">&#x2a;</xref>
<xref ref-type="fn" rid="fn1">
<sup>&#x2020;</sup>
</xref>
<uri xlink:href="https://loop.frontiersin.org/people/1091725/overview"/>
</contrib>
<contrib contrib-type="author">
<name>
<surname>Safavi-Hemami</surname>
<given-names>Helena</given-names>
</name>
<xref ref-type="aff" rid="aff1">
<sup>1</sup>
</xref>
<xref ref-type="aff" rid="aff2">
<sup>2</sup>
</xref>
<xref ref-type="aff" rid="aff3">
<sup>3</sup>
</xref>
</contrib>
<contrib contrib-type="author">
<name>
<surname>Olivera</surname>
<given-names>Baldomero M.</given-names>
</name>
<xref ref-type="aff" rid="aff1">
<sup>1</sup>
</xref>
<uri xlink:href="https://loop.frontiersin.org/people/874227/overview"/>
</contrib>
</contrib-group>
<aff id="aff1">
<sup>1</sup>
<institution>School of Biological Sciences</institution>, <institution>University of Utah</institution>, <addr-line>Salt Lake City</addr-line>, <addr-line>UT</addr-line>, <country>United&#x20;States</country>
</aff>
<aff id="aff2">
<sup>2</sup>
<institution>Department of Biomedical Sciences</institution>, <institution>University of Copenhagen</institution>, <addr-line>Copenhagen</addr-line>, <country>Denmark</country>
</aff>
<aff id="aff3">
<sup>3</sup>
<institution>Department of Biochemistry</institution>, <institution>University of Utah</institution>, <addr-line>Salt Lake City</addr-line>, <addr-line>UT</addr-line>, <country>United&#x20;States</country>
</aff>
<author-notes>
<fn fn-type="edited-by">
<p>
<bold>Edited by:</bold> <ext-link ext-link-type="uri" xlink:href="https://loop.frontiersin.org/people/503374/overview">Maria Elena De Lima</ext-link>, Grupo Santa Casa BH, Brazil</p>
</fn>
<fn fn-type="edited-by">
<p>
<bold>Reviewed by:</bold> <ext-link ext-link-type="uri" xlink:href="https://loop.frontiersin.org/people/1489448/overview">Ronald Jenner</ext-link>, Natural History Museum, United&#x20;Kingdom</p>
<p>
<ext-link ext-link-type="uri" xlink:href="https://loop.frontiersin.org/people/733874/overview">Ricardo C. Rodr&#xed;guez De La Vega</ext-link>, Universit&#xe9; Paris-Sud, France</p>
</fn>
<corresp id="c001">&#x2a;Correspondence: Maren Watkins, <email>maren.watkins@hsc.utah.edu</email>
</corresp>
<fn fn-type="equal" id="fn1">
<label>
<sup>&#x2020;</sup>
</label>
<p>These authors have contributed equally to this work and share first authorship</p>
</fn>
<fn fn-type="other">
<p>This article was submitted to Cellular Biochemistry, a section of the journal Frontiers in Molecular Biosciences</p>
</fn>
</author-notes>
<pub-date pub-type="epub">
<day>21</day>
<month>02</month>
<year>2022</year>
</pub-date>
<pub-date pub-type="collection">
<year>2022</year>
</pub-date>
<volume>9</volume>
<elocation-id>784419</elocation-id>
<history>
<date date-type="received">
<day>27</day>
<month>09</month>
<year>2021</year>
</date>
<date date-type="accepted">
<day>18</day>
<month>01</month>
<year>2022</year>
</date>
</history>
<permissions>
<copyright-statement>Copyright &#xa9; 2022 Chase, Watkins, Safavi-Hemami and Olivera.</copyright-statement>
<copyright-year>2022</copyright-year>
<copyright-holder>Chase, Watkins, Safavi-Hemami and Olivera</copyright-holder>
<license xlink:href="http://creativecommons.org/licenses/by/4.0/">
<p>This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these&#x20;terms.</p>
</license>
</permissions>
<abstract>
<p>The venomous marine snails are conventionally divided into three groups, the cone snails (family Conidae), the auger snails (family Terebridae) and the turrids (formerly all assigned to a single family, Turridae). In this study, a library of venom peptides from species conventionally assigned to the genus <italic>Turris</italic> was correlated to a phylogenetic analysis. Nucleotide sequences of multiple genes from transcriptomes were used to assess the phylogenetic relationships across a diverse set of species. The resulting tree shows that as conventionally defined, the conoidean genus <italic>Turris</italic>, is polyphyletic. We describe a new genus, <italic>Purpuraturris gen. nov.</italic>, that comprises the outlier species. In addition to morphological distinctions, molecular data reveal that this group is divergent from <italic>Turris sensu stricto</italic>. The correlation between phylogenetic information and a family of peptide sequences was used to highlight those peptides mostly likely to be unique and intimately associated with biological diversity. The plethora of peptide sequences available requires two prioritization decisions: which subset of peptides to initially characterize, and after these are characterized, which to comprehensively investigate for potential biomedical applications such as drug developments.</p>
<p>
<bold>Life Science Identifiers:</bold> urn:lsid:zoobank.org; pub: 60D46561-28F0-4C39-BAC4-66DC8B4EAEA4</p>
</abstract>
<kwd-group>
<kwd>turripeptides</kwd>
<kwd>conoidean venoms</kwd>
<kwd>phylogenetics</kwd>
<kwd>peptide libraries</kwd>
<kwd>
<italic>Turris</italic>
</kwd>
<kwd>
<italic>Purpuraturris</italic>
</kwd>
</kwd-group>
<contract-num rid="cn001">P01GM048677 R01GM122869</contract-num>
<contract-num rid="cn002">W81XWH-17-1-0413</contract-num>
<contract-num rid="cn003">19063</contract-num>
<contract-sponsor id="cn001">National Institute of General Medical Sciences<named-content content-type="fundref-id">10.13039/100000057</named-content>
</contract-sponsor>
<contract-sponsor id="cn002">U.S. Department of Defense<named-content content-type="fundref-id">10.13039/100000005</named-content>
</contract-sponsor>
<contract-sponsor id="cn003">Villum Fonden<named-content content-type="fundref-id">10.13039/100008398</named-content>
</contract-sponsor>
</article-meta>
</front>
<body>
<sec id="s1">
<title>Introduction</title>
<p>Evolution has crafted an exquisite library of bioactive peptides expressed in the venomous species of the world. This vast diversity of bioactive peptides has long been recognized as a tremendous pharmacological resource (<xref ref-type="bibr" rid="B20">Lewis and Garcia, 2003</xref>; <xref ref-type="bibr" rid="B5">Chen et&#x20;al., 2018</xref>; <xref ref-type="bibr" rid="B31">Pennington et&#x20;al., 2018</xref>). Historically, obtaining a single peptide sequence from individual specimens was so laborious that almost any peptide with a known primary sequence was heavily investigated. Recent technological advances have made identifying primary peptide sequences facile, placing nearly the entire library at our fingertips. As a result, the available sequences of venom peptides are undergoing an explosive growth phase. This creates a general problem for the field of venom research&#x2014;the ever-expanding catalog of peptide sequences has far outstripped our present capacity to elucidate the mechanisms that underlie their activity. For this reason, prioritizing which venom peptide to investigate is becoming increasingly important. Here we demonstrate that leveraging the phylogeny of common housekeeping genes against the phylogeny of a family of peptide sequences can highlight which peptide sequences are most likely to be unique and intimately associated with biological diversity. By organizing venom peptide sequences using this phylogenetic framework, the ever-expanding venom peptide libraries can be correlated and assembled into groups that reflect the underlying biology of the animals.</p>
<p>The focus of this paper is a library of venom peptides generated by species traditionally assigned to the genus <italic>Turris</italic>, the type genus of the family Turridae (turrids). Turrids are one of the lesser-known venomous marine snails in the superfamily Conoidea. Compared to some other groups in the superfamily, such as the cone snails (family Conidae), the turrids are a relatively neglected lineage. We illustrate how the correlation between phylogenetic information and peptide sequences obtained from multiple species in a turrid lineage provides useful insights into what otherwise might seem like a confusing group of peptides.</p>
<p>The Superfamily Conoidea (<xref ref-type="fig" rid="F1">Figures 1</xref>, <xref ref-type="fig" rid="F2">2</xref>) is a biodiverse lineage of predatory marine snails, the vast majority of which are venomous (<xref ref-type="bibr" rid="B30">Olivera et&#x20;al., 2014</xref>). The best known are the cone snails (family Conidae). A second familiar group are the auger snails (family Terebridae), which are highly adapted to sandy marine habitats (<xref ref-type="bibr" rid="B10">Holford et&#x20;al., 2009</xref>). Traditionally, all other conoideans were included in the family Turridae (<xref ref-type="bibr" rid="B4">Bouchet, 1990</xref>), but it became apparent that this was a heterogenous group. In recent years, the family Turridae has been restricted only to the conoidean lineages more closely-related to the type species, <italic>Turris babylonia</italic> (the Tower of Babel turrid); most other species formerly included in Turridae are now assigned to other families (<xref ref-type="bibr" rid="B33">Puillandre et&#x20;al., 2008</xref>; <xref ref-type="bibr" rid="B3">Bouchet et&#x20;al., 2011</xref>), many of which were formerly regarded as subfamilies of Turridae. Even in its reduced form, the taxonomy and phylogeny of the family has presented several confusing taxonomic and phylogenetic problems [perhaps aptly symbolized by having the Tower of Babel turrid as type species (<xref ref-type="bibr" rid="B29">Olivera et&#x20;al., 2010</xref>)]. The subfamilies and genera within the family Turridae have not been treated in a consistent manner, and very often, even well-known species have been assigned to different genera at various times (<xref ref-type="bibr" rid="B11">Horton et&#x20;al., 2021</xref>). These types of taxonomic problems are generally true of the more biodiverse lineages of venomous animals.</p>
<fig id="F1" position="float">
<label>FIGURE 1</label>
<caption>
<p>The nine species conventionally assigned to the genus <italic>Turris</italic> for which a venom gland transcriptome is available are shown. Top row left to right: <italic>Turris dollyae</italic>, <italic>Turris guidopoppei</italic>, <italic>Turris hidalgoi</italic>, <italic>Turris normandavidsoni</italic>, <italic>Turris spectabilis</italic>. The species shown on the lower row were assigned to the genus <italic>Turris</italic>, but as will be demonstrated through the data obtained in this work, they belong to a new genus, <italic>Purpuraturris</italic>. From left to right: <italic>Purpuraturris cristata</italic>; <italic>Purpuraturris cryptorraphe</italic>; <italic>Purpuraturris undosa</italic>; <italic>Purpuraturris nadaensis</italic>. The shells were photographed individually and the photographs were cropped to maintain the size of the shells relative to each other. The scale bar represents an approximate length of 1&#xa0;cm (Photographed by Samuel Espino.)</p>
</caption>
<graphic xlink:href="fmolb-09-784419-g001.tif"/>
</fig>
<fig id="F2" position="float">
<label>FIGURE 2</label>
<caption>
<p>Conoidean families and genera included in the transcriptome-based phylogenetic tree. The six specimens on the left belong to the family Turridae, followed by three specimens in the family Conidae. The two rightmost specimens belong to the family Terebridae and the two next to them are in the family Drilliidae. Starting with the leftmost specimen, and going clockwise: Family Turridae: <italic>Turris</italic> (<italic>Turris dollyae</italic>); <italic>Iotyrris</italic> (<italic>Iotyrris cingulifera</italic>); <italic>Unedogemmula</italic> (<italic>Unedogemmula unedo</italic>); <italic>Lophiotoma</italic> (<italic>Lophiotoma picturata</italic>); <italic>Purpuraturris</italic> (<italic>Purpuraturris cryptorraphe</italic>); <italic>Gemmula</italic> (<italic>Gemmula lisajoni</italic>). Family Conidae: <italic>Conus</italic> (<italic>Conus radiatus</italic>); <italic>Californiconus</italic> (<italic>Californiconus californicus</italic>); <italic>Conasprella</italic> (<italic>Conasprella ichnoseana</italic>). Family Drilliidae: <italic>Drillia</italic> (<italic>Drillia regia</italic>); <italic>Clavus</italic> (<italic>Clavus canalicularis</italic>). Family Terebridae: <italic>Hastula</italic> (<italic>Hastula matheroniana</italic>); <italic>Terebra</italic> (<italic>Terebra subulata</italic>). The shells were photographed individually and the photographs were cropped to maintain the size of the shells relative to each other. The scale bar represents an approximate length of 1&#xa0;cm (Photographed by Samuel Espino).</p>
</caption>
<graphic xlink:href="fmolb-09-784419-g002.tif"/>
</fig>
<p>In this study, we have used a new approach to investigate the phylogeny of the Turridae, with a specific focus on the genus <italic>Turris</italic>. Because recent advances in transcriptome sequencing have made it possible to sequence the venom gland of most if not all available venomous species, we have assessed phylogenetic relationships within the family Turridae and other conoidean families based on the venom gland transcriptomes of 35 conoidean species. The results presented here confirm the finding by <xref ref-type="bibr" rid="B6">Fedosov et&#x20;al. (2011)</xref> that the type genus of the family Turridae, the genus <italic>Turris</italic>, is not monophyletic. The species in the genus can be divided into two major groups, those species most closely related to the type, <italic>Turris babylonia</italic>, and a second group, which on the basis of our phylogenetic analysis should not be assigned to <italic>Turris</italic>. The solution we propose is the creation of a new genus, <italic>Purpuraturris gen. nov.</italic>, with <italic>Purpuraturris cryptorrhaphe</italic> (formerly <italic>Turris cryptorrhaphe</italic>) as the type species.</p>
<p>Phylogenetic analysis based on the nucleotide sequences of a set of common genes that are expressed in the transcriptomes of these conoidean molluscs yields a surprisingly robust phylogeny (<xref ref-type="fig" rid="F3">Figure&#x20;3</xref>). This is consistent with recent findings on the use of gene fragments obtained by exon capture for the phylogenetic reconstruction of the conoidean tree (<xref ref-type="bibr" rid="B1">Abdelkrim et&#x20;al., 2018</xref>). Our results suggest that the family Turridae is the sister group of the clade which includes both family Terebridae and family Drillidae, and that the group of species formerly in <italic>Turris</italic> that do not belong in that genus fall in a separate major branch of the family Turridae. The phylogenetic framework we established for <italic>Turris</italic> was then used to analyze a family of venom peptides, two closely-related divisions in the P-like Turripeptide Superfamily. The analysis of this family of peptides was correlated to the phylogenetic information; the results are presented and discussed.</p>
<fig id="F3" position="float">
<label>FIGURE 3</label>
<caption>
<p>Maximum likelihood phylogenetic tree based on transcriptome sequences from 66 contigs with blast identity to common housekeeping genes. The tree shown here represents the consensus tree from the 66 individual gene trees. The values at the nodes indicate the fraction of individual gene trees that support that node. The lengths of the terminal branches are undetermined. Conoidean families are labelled and representative images&#x20;shown.</p>
</caption>
<graphic xlink:href="fmolb-09-784419-g003.tif"/>
</fig>
</sec>
<sec sec-type="results" id="s2">
<title>Results</title>
<sec id="s2-1">
<title>Phylogenetic Analysis of Superfamily Conoidea Based on Transcriptomes</title>
<p>Our laboratories have carried out an extensive analysis of the transcriptomes of venom glands of cone snails (family Conidae) (<xref ref-type="bibr" rid="B37">Safavi-Hemami et&#x20;al., 2016</xref>; <xref ref-type="bibr" rid="B21">Li et&#x20;al., 2017</xref>; <xref ref-type="bibr" rid="B35">Robinson et&#x20;al., 2017</xref>; <xref ref-type="bibr" rid="B22">Li et&#x20;al., 2018</xref>; <xref ref-type="bibr" rid="B23">Lu et&#x20;al., 2020</xref>). This information has greatly facilitated the characterization of bioactive venom components. We have also analyzed a number of taxa in the superfamily Conoidea which are not cone snails; many of these belong to the family Turridae (<xref ref-type="fig" rid="F1">Figures 1</xref>&#x2013;<xref ref-type="fig" rid="F3">3</xref>, <xref ref-type="sec" rid="s10">Supplementary Tables S1, S2</xref>). However, species in some other conoidean families, including Terebridae and Drilliidae, have also been analyzed (see <xref ref-type="fig" rid="F2">Figures 2</xref>,&#x20;<xref ref-type="fig" rid="F3">3</xref>).</p>
<p>Using these datasets, we have developed a method for phylogenetic analysis based on common transcripts recovered from transcriptomic data; a detailed description of the procedures and protocols is provided in the Methods section. This approach should be applicable to any molluscan group. The results of this analysis, shown in <xref ref-type="fig" rid="F3">Figure&#x20;3</xref>, include nine different species conventionally assigned to the genus <italic>Turris</italic>. The results clearly demonstrate that <italic>Turris</italic>, as conventionally defined, is polyphyletic, and that a subset of species is only distantly related to the major group. We describe a new genus, <italic>Purpuraturris gen. nov.</italic>, to include this subset of outlier species (<xref ref-type="other" rid="app1">see Appendix 1</xref>). The phylogenetic tree in <xref ref-type="fig" rid="F3">Figure&#x20;3</xref> demonstrates that the family Turridae has two major divisions. The four species (<italic>cryptorraphe</italic>, <italic>cristata</italic>, <italic>undosa</italic>, <italic>nadaensis</italic>) formerly assigned to <italic>Turris</italic> are not in the same branch as the other five species in <italic>Turris</italic> (<italic>guidopoppei</italic>, <italic>hidalgoi</italic>, <italic>spectabilis</italic>, <italic>dollyae, normandavidsoni</italic>).</p>
<p>The proposed new genus includes these four species conventionally assigned to <italic>Turris</italic>, but for which the genetic data are incompatible with that assignment. The molecular results suggest that these species are unrelated to their former congeners in the genus <italic>Turris</italic>. Additionally, as a group these species are morphologically distinct and share a number of characters that justify creation of a new genus. Because they have some morphological characters similar to <italic>Turris</italic> (i.e.,&#x20;the position of the slit, the thin linear cleft in the margin of the aperture), but also have differentiating characters, notably a distinctive purplish color, particularly within the aperture, we have chosen the name <italic>Purpuraturris gen. nov</italic>. The type species of the new genus is <italic>Purpuraturris cryptorrhaphe</italic> (formerly <italic>Turris cryptorrhaphe</italic>). The transcriptomic data indicate that <italic>Purpuraturris nadaensis, Purpuraturris undosa</italic> and <italic>Purpuraturris cristata</italic> are congeners. This taxonomic placement is supported by the phylogenetic tree constructed using standard genetic markers (<xref ref-type="fig" rid="F4">Figure&#x20;4</xref>). A conventional taxonomic description of the new genus is provided in <xref ref-type="other" rid="app1">Appendix 1</xref>.</p>
<fig id="F4" position="float">
<label>FIGURE 4</label>
<caption>
<p>Maximum likelihood phylogenetic tree of Turridae with bootstrap support values. The tree uses standard phylogenetic markers (the GenBank accession numbers and publication references are listed in <xref ref-type="sec" rid="s10">Supplementary Table S5</xref>) and was constructed as described under Methods. We have marked with an asterisk the species that were formerly assigned to the genus <italic>Turris</italic>; as shown in the tree, these are widely separated into two groups, <italic>Turris</italic>, colored purple (now all assigned to the genus <italic>Turris senso stricto</italic>) and the turquoise branch (assigned to the new genus <italic>Purpuraturris gen. nov.</italic>) The tree illustrates some of the remaining taxonomic problems in Turridae: note that species conventionally assigned to <italic>Gemmula</italic> fall in multiple branches, while there is no separation between <italic>Xenuroturris</italic> and <italic>iotyrris</italic>.</p>
</caption>
<graphic xlink:href="fmolb-09-784419-g004.tif"/>
</fig>
</sec>
<sec id="s2-2">
<title>P-Like Turripeptides</title>
<p>The specific family of venom peptides that is the focus of this study are venom peptides from species formerly assigned to the genus <italic>Turris</italic>; these belong to a group known as the P-like turripeptides (<xref ref-type="bibr" rid="B42">Watkins et&#x20;al., 2006</xref>). This nomenclature is derived from the number and arrangement of cysteine residues in these peptides, which are shared with the P-superfamily of conotoxins (<xref ref-type="bibr" rid="B36">Robinson and Norton, 2014</xref>). A description of the nomenclature adopted for turrid venom peptides is provided in <xref ref-type="sec" rid="s11">Appendix 2</xref>. Based on their signal sequences, propeptides, and cysteine loop sizes, these can either be regarded as a single superfamily of venom peptides, or as two closely-related superfamilies (see PII and PIII superfamilies, <xref ref-type="sec" rid="s10">Supplementary Table S1</xref>). This superfamily was chosen due to the presence of multiple venom peptides from both <italic>Turris</italic> and <italic>Purpuraturris</italic>. The predicted mature peptide sequences are shown in <xref ref-type="table" rid="T1">Table&#x20;1</xref>, while a tree that shows how the sequences are related, along with the alignment of the precursor sequences used to generate the tree are presented in <xref ref-type="fig" rid="F5">Figure&#x20;5</xref>. The precursor sequences are listed in <xref ref-type="sec" rid="s10">Supplementary Table S1</xref>, divided into P-like turripeptide superfamily PII, consisting of Clades I and II in <xref ref-type="fig" rid="F5">Figure&#x20;5</xref>, and P-like turripeptide superfamily PIII, consisting of Clades III and IV in <xref ref-type="fig" rid="F5">Figure&#x20;5</xref>.</p>
<table-wrap id="T1" position="float">
<label>TABLE 1</label>
<caption>
<p>Predicted mature P-like turripeptide sequences.</p>
</caption>
<table>
<thead valign="top">
<tr>
<th align="left">Species</th>
<th align="center">Toxin name</th>
<th align="center">Predicted mature peptide sequence</th>
</tr>
</thead>
<tbody valign="top">
<tr>
<td colspan="3" align="left">Clade I P-like turripeptides</td>
</tr>
<tr>
<td align="left">
<bold>
<italic>&#x2003;</italic>
</bold>
<italic>Turris babylonia</italic>
</td>
<td align="left">Tba9.3</td>
<td align="left">DACPGNEAKCFSTECTNPSSHGYDSQECQDACQYVWDYCSEE</td>
</tr>
<tr>
<td align="left">
<bold>
<italic>&#x2003;</italic>
</bold>
<italic>Turris guidopoppei</italic>
</td>
<td align="left">Tgd9.1</td>
<td align="left">DACPEYEAKCFSTECTDEDSDGYDSPECQAACQYVWDHCSED</td>
</tr>
<tr>
<td align="left">
<bold>
<italic>&#x2003;</italic>
</bold>
<italic>Turris hidalgoi</italic>
</td>
<td align="left">Thd9.5</td>
<td align="left">DACPENKVKCFSTECMNLESDGYDSAECQAACQYVYDQCPEE</td>
</tr>
<tr>
<td align="left">
<bold>
<italic>&#x2003;</italic>
</bold>
<italic>Turris normandavidsoni</italic>
</td>
<td align="left">Tnr9.2</td>
<td align="left">DACPENEAKCYSTECTNQQADGYDSSECQAACQYVWNHCSYE</td>
</tr>
<tr>
<td colspan="3" align="left">Clade II P-like turripeptides</td>
</tr>
<tr>
<td align="left">
<bold>
<italic>&#x2003;</italic>
</bold>
<italic>Purpuraturris nadaensis</italic>
</td>
<td align="left">Pnd9.13</td>
<td align="left">DLCDESLANCTSSSCQAELENENGSSACTEACDYWVANCQE</td>
</tr>
<tr>
<td align="left">
<bold>
<italic>&#x2003;</italic>
</bold>
<italic>Purpuraturris cryptorrhaphe</italic>
</td>
<td align="left">Pcr9.4ii</td>
<td align="left">DLCDEYLENCTSPYCQEQSNIQNGSSACNEACNYWDKNCRTPDEEQ</td>
</tr>
<tr>
<td align="left">
<bold>
<italic>&#x2003;</italic>
</bold>
<italic>Purpuraturris cryptorrhaphe</italic>
</td>
<td align="left">Pcr9.4</td>
<td align="left">DLCDEYLENCTSPYCQEQSNIQNGDGACNEACNYWDKNCRTPDEEQ</td>
</tr>
<tr>
<td align="left">
<bold>
<italic>&#x2003;</italic>
</bold>
<italic>Purpuraturris nadaensis</italic>
</td>
<td align="left">Pna9.11</td>
<td align="left">ACEDSLEECTSEFCIEQSATQNGNAACNSACNYWYHNCQE</td>
</tr>
<tr>
<td align="left">
<italic>Purpuraturris nadaensis</italic>
</td>
<td align="left">Pna9.12</td>
<td align="left">DACEDHLEYCTSEFCIEQSYIQNGNATCQNACYDWYQNCQ</td>
</tr>
<tr>
<td align="left">
<bold>
<italic>&#x2003;</italic>
</bold>
<italic>Purpuraturris nadaensis</italic>
</td>
<td align="left">Pna9.31</td>
<td align="left">DACEDNLEDCTSEFCIEQSATQNGNAACNSACSDWYHNCQ</td>
</tr>
<tr>
<td align="left">
<bold>
<italic>&#x2003;</italic>
</bold>
<italic>Purpuraturris cristata</italic>
</td>
<td align="left">Pcs9.1</td>
<td align="left">DACESNLETCTSLECMTELQTQTASPACNNACSNYTSNC</td>
</tr>
<tr>
<td align="left">
<bold>
<italic>&#x2003;</italic>
</bold>
<italic>Purpuraturris nadaensis</italic>
</td>
<td align="left">Pna9.29</td>
<td align="left">DACQETFEYCTSDFCMEELEYEDANVTCVDACNIWLANCQ</td>
</tr>
<tr>
<td align="left">
<italic>Purpuraturris nadaensis</italic>
</td>
<td align="left">Pna9.10</td>
<td align="left">DVCEENRVHCTSPFCQEELEYEDANVTCVDACNIWLANCQ</td>
</tr>
<tr>
<td align="left">
<bold>
<italic>&#x2003;</italic>
</bold>
<italic>Purpuraturris nadaensis</italic>
</td>
<td align="left">Pna9.10ii</td>
<td align="left">&#xfeff;DVCEENRVHCTSPFCQEELEYEDANVTCVDACNIWLANCQ</td>
</tr>
<tr>
<td align="left">
<bold>
<italic>&#x2003;</italic>
</bold>
<italic>Purpuraturris undosa</italic>
</td>
<td align="left">Pun9.4</td>
<td align="left">DVCEENRVHCTSPFCQEELEYEDANVTCVDACNIWLANCQ</td>
</tr>
<tr>
<td align="left">
<bold>
<italic>&#x2003;</italic>
</bold>
<italic>Purpuraturris nadaensis</italic>
</td>
<td align="left">Pna9.2ii</td>
<td align="left">DVCEDNRVYCTSPFCQEELEYEDANVTCVDACNIWLANCQE</td>
</tr>
<tr>
<td align="left">
<bold>
<italic>&#x2003;</italic>
</bold>
<italic>Purpuraturris nadaensis</italic>
</td>
<td align="left">Pna9.2</td>
<td align="left">DVCEDNRVYCTSPFCQEELEYEDANVTCVDACNIWFANCQE</td>
</tr>
<tr>
<td colspan="3" align="left">Clade III P-Clade like turripeptides</td>
</tr>
<tr>
<td align="left">
<bold>
<italic>&#x2003;</italic>
</bold>
<italic>Turris hidalgoi</italic>
</td>
<td align="left">Thd9.1</td>
<td align="left">QNNNCGCGSADVGRNCPGFGFCSDGTCSVSNTCEF</td>
</tr>
<tr>
<td align="left">
<bold>
<italic>&#x2003;</italic>
</bold>
<italic>Turris spectabilis</italic>
</td>
<td align="left">Tsp9.1</td>
<td align="left">QNNNCGCASTDVGKPCPGSGLCGSGTCSVLNTCDFE</td>
</tr>
<tr>
<td align="left">
<bold>
<italic>&#x2003;</italic>
</bold>
<italic>Turris spectabilis</italic>
</td>
<td align="left">Tsp9.2ii</td>
<td align="left">NNNNCGCGSTDVGQPCPGYGLCNDGICSALNTCDFSVN</td>
</tr>
<tr>
<td align="left">
<bold>
<italic>&#x2003;</italic>
</bold>
<italic>Turris spectabilis</italic>
</td>
<td align="left">Tsp9.2</td>
<td align="left">NNNNCGCGSTDVGQPCPGYGLCNDGICSALNTCDFEI</td>
</tr>
<tr>
<td align="left">
<bold>
<italic>&#x2003;</italic>
</bold>
<italic>Turris guidopoppei</italic>
</td>
<td align="left">Tgd9.5</td>
<td align="left">QSNCGCGNTNVGLPCPGTGLCSGICSIAHTCESVDL</td>
</tr>
<tr>
<td align="left">
<bold>
<italic>&#x2003;</italic>
</bold>
<italic>Turris hidalgoi</italic>
</td>
<td align="left">Thd9.2</td>
<td align="left">QNCGCGNTGVDQPCPGSGMCINGICTVAYTCKT</td>
</tr>
<tr>
<td align="left">
<bold>
<italic>&#x2003;</italic>
</bold>
<italic>Turris babylonia</italic>
</td>
<td align="left">Tba9.4</td>
<td align="left">QNNCGCGHINVNQPCPESGSGCSGGYYSSAHTCEY</td>
</tr>
<tr>
<td align="left">
<bold>
<italic>&#x2003;</italic>
</bold>
<italic>Turris babylonia</italic>
</td>
<td align="left">Tba9.5</td>
<td align="left">QNNCGCSNRNAGYPCPESSNECSGGVCSLAHTCEL</td>
</tr>
<tr>
<td colspan="3" align="left">Clade IV P-Like turripeptides</td>
</tr>
<tr>
<td align="left">
<bold>
<italic>&#x2003;</italic>
</bold>
<italic>Turris hidalgoi</italic>
</td>
<td align="left">Thd9.10</td>
<td align="left">WYDCTCEGVEVGSTCSGNNCAAVCRSDGGCWF</td>
</tr>
<tr>
<td align="left">
<bold>
<italic>&#x2003;</italic>
</bold>
<italic>Turris normandavidsoni</italic>
</td>
<td align="left">Tnr9.4</td>
<td align="left">DDCSCEGVEVDSTCSGNSCAAICRSDGRCWI</td>
</tr>
<tr>
<td align="left">
<bold>
<italic>&#x2003;</italic>
</bold>
<italic>Turris guidopoppei</italic>
</td>
<td align="left">Tgd9.6</td>
<td align="left">WYDCTCVEVGSTCSGNSCAAVCRSDVGCWI</td>
</tr>
<tr>
<td align="left">
<bold>
<italic>&#x2003;</italic>
</bold>
<italic>Turris guidopoppei</italic>
</td>
<td align="left">Tgd9.15</td>
<td align="left">LYDCTCEGVEVGSTCSGNSCAAVCRSDGGCWI</td>
</tr>
<tr>
<td align="left">
<bold>
<italic>&#x2003;</italic>
</bold>
<italic>Turris normandavidsoni</italic>
</td>
<td align="left">Tnr9.3ii</td>
<td align="left">HGCSCEGVEVGSTCSGNDCAAVCRSDGGCWIST</td>
</tr>
<tr>
<td align="left">
<bold>
<italic>&#x2003;</italic>
</bold>
<italic>Turris normandavidsoni</italic>
</td>
<td align="left">Tnr9.3</td>
<td align="left">HGCSCEGVEVGSTCSGNDCAAVCRSDGGCWIST</td>
</tr>
<tr>
<td align="left">
<bold>
<italic>&#x2003;</italic>
</bold>
<italic>Turris dollyae</italic>
</td>
<td align="left">Tdo9.4</td>
<td align="left">HGCSCEGVEVGSTCAGNDCAAVCRSDGGCWIST</td>
</tr>
</tbody>
</table>
</table-wrap>
<fig id="F5" position="float">
<label>FIGURE 5</label>
<caption>
<p>Maximum likelihood phylogenetic tree with bootstrap support values showing the major divisions of P-like turripeptides identified in <italic>Turris</italic> and <italic>Purpuraturris</italic> species into four discrete branches, labeled Clades I-IV. <italic>Purpuraturris</italic> is found only in Clade II. <bold>(A)</bold> phylogenetic tree, <bold>(B)</bold> multiple sequence alignment used to generate the tree, <bold>(C)</bold> Expression levels of turripeptides identified in transcriptomes relative to the mean expression of HKG in the same transcriptome [log<sub>2</sub> (turripeptide<sub>TPM</sub>/HKG<sub>meanTPM</sub>) of the housekeeping fold change].</p>
</caption>
<graphic xlink:href="fmolb-09-784419-g005.tif"/>
</fig>
<p>It is clear from this tree that the peptide sequences fall into discrete branches, which we have labeled Clades I&#x2013;IV. It is notable that each branch of the tree either has species from <italic>Turris</italic> s.s. (as redefined above), or only species that have been removed from the genus <italic>Turris</italic> and reassigned to the proposed new genus, <italic>Purpuraturris gen. nov</italic>. None of the branches have a mixture of species from both genera. Thus, the grouping of several species in a given branch is consistent with and supportive of the phylogenetic trees shown in <xref ref-type="fig" rid="F3">Figures 3</xref>, <xref ref-type="fig" rid="F4">4</xref>. The peptide tree reflects the phylogenetic relationships between the various taxa analyzed: the species in <italic>Turris</italic> are not closely-related to species in <italic>Purpuraturris</italic>, leading to the pattern of divergence in their venom peptides observed in <xref ref-type="fig" rid="F5">Figure&#x20;5</xref>. The tree of peptide sequences has two major branches; in one major branch, there are two clades, with each subgroup containing sequences only from <italic>Turris</italic> s.s., or <italic>Purpuraturris</italic> species; in contrast, the second major branch has two clades, both having only species assigned to <italic>Turris</italic> whereas peptides from <italic>Purpuraturris</italic> are absent. Thus, a juxtaposition of the trees based on evolutionary relationships between species in <xref ref-type="fig" rid="F3">Figures 3</xref>, <xref ref-type="fig" rid="F4">4</xref>, and on peptide sequence similarities in <xref ref-type="fig" rid="F5">Figure&#x20;5</xref> suggests that the divergence between the two major divisions of the P-like turripeptides shown in <xref ref-type="fig" rid="F5">Figure&#x20;5</xref> may have predated the divergence of <italic>Purpuraturris</italic> from <italic>Turris</italic>. Alternatively, it is possible that the divergence of Clades III and IV may have predated the divergence of Clade II (<italic>Purpuraturris</italic>) from Clade I (<italic>Turris</italic>) with a subsequent loss of these two lineages from <italic>Purpuraturris</italic>.</p>
<p>We note that the sequences of the mature peptides in the two major branches have strikingly divergent features. The two clades in the major branch found only in <italic>Turris</italic> species (Clades III and IV) have P-like turripeptides each with a single amino acid between the first two cysteine residues; in Clades I and II there are six amino acids between the first two cysteine residues, with the consensus sequence of: (E/P) EN (E/L) (A/E)&#x20;X.</p>
</sec>
<sec id="s2-3">
<title>Venom Peptide Libraries: From Families of Sequences to Experimental Strategies</title>
<p>The venom peptide family that is analyzed in <xref ref-type="fig" rid="F5">Figure&#x20;5</xref> and <xref ref-type="table" rid="T1">Table&#x20;1</xref> has over 30 related sequences. In <xref ref-type="fig" rid="F5">Figure&#x20;5</xref>, we have subdivided the major branches into four defined clades; the phylogenetic framework indicates that the peptides in Clade II should be considered separately from the peptides in Clade I, III and IV, since the divergence established by the phylogenetic trees in <xref ref-type="fig" rid="F3">Figures 3</xref>, <xref ref-type="fig" rid="F4">4</xref> indicate that these peptides may have evolved as part of an entirely different biological strategy, from two lineages of venomous animals that are long diverged. Nevertheless, Clades I, III and IV, still raise the issue of how to efficiently analyze this library of diverse peptides. Using phylogenetic methodology to compare sequences resulted in the discovery that peptides from <italic>Turris</italic> venoms that belong to the P-like turripeptide group fall into three clades; if sufficient resources were available, at least one peptide from each clade should be characterized, since it is likely that these may act through divergent mechanisms. Even within each clade of peptides, there are too many to comprehensively characterize. In the most complex group, Clade III, the mature peptide sequences can be clustered into two groups; the peptide sequences from <italic>Turris hidalgoi</italic> have representatives in each of these Clade III subgroups, i.e.,&#x20;Thd9.2 defining one group, and Thdg9.1 defining the second.</p>
<p>The use of a transcriptomic approach to building the phylogenetic tree automatically reveals relative expression levels (<xref ref-type="fig" rid="F5">Figure&#x20;5C</xref>). If the expression levels of the two <italic>T. hidalgoi</italic> peptides in Clade III are compared, by far the most highly-expressed is Thd9.1. The high-expression level of Thd9.1 would more easily facilitate characterization and thus favor prioritization of this peptide for further&#x20;study.</p>
</sec>
</sec>
<sec sec-type="discussion" id="s3">
<title>Discussion</title>
<sec id="s3-1">
<title>Using Transcriptomics for the Analysis of Conoidean Venoms</title>
<p>In the superfamily Conoidea, the increasing number of comprehensive transcriptomic analyses of venom glands has made it possible to routinely generate native venom peptide libraries. This is particularly facile for conoidean venoms because of how venom peptide precursors are organized. The typical conoidean venom gland has a repertoire of approximately 200 different peptides encoded and expressed by epithelial cells lining the gland in each species. The accelerated evolution of these venom peptide genes results in the mature peptide regions being hypervariable, except for the cysteine residues which provide a conserved framework for genetically related peptides. Because the signal sequences are also very highly conserved, it is straightforward to identify related peptides in each conoidean lineage. In this study, we demonstrate how the transcriptomic analysis of one lineage can be used to identify a peptide family, and in addition, to reveal phylogenetic relationships. Until recently, this type of analysis was significantly more difficult, since obtaining a comprehensive transcriptome was much more cumbersome and expensive.</p>
</sec>
<sec id="s3-2">
<title>Analysis of P-like Turripeptides</title>
<p>The peptide family we analyzed in this study was obtained from the venom glands of species conventionally assigned to a single genus, <italic>Turris</italic>. One previously characterized group of venom peptides in turrids are the P-like turripeptides (<xref ref-type="bibr" rid="B9">Heralde et&#x20;al., 2008</xref>), which have six cysteine residues in a pattern characteristic of <italic>Conus</italic> P-superfamily peptides (<xref ref-type="bibr" rid="B36">Robinson and Norton, 2014</xref>) but which are otherwise unrelated. There is more than one gene superfamily that encodes peptides of this type in these species (<xref ref-type="bibr" rid="B42">Watkins et&#x20;al., 2006</xref>) &#x2014;&#x20;in this study, we focused on a subset of P-like turripeptides with related signal sequences. The precursor sequences, which are the data used to predict sequences of the mature bioactive venom peptides, are shown in <xref ref-type="fig" rid="F5">Figure&#x20;5</xref> and <xref ref-type="sec" rid="s10">Supplementary Table S1</xref>. In some cases, P-like turripeptide precursor sequences were obtained using PCR or sequencing of cDNA libraries rather than from transcriptomes, indicated in <xref ref-type="sec" rid="s10">Supplementary Table S1</xref> by asterisks. In a few cases, P-like turritoxin precursor sequences were obtained from a transcriptome of a specimen other than that used for the neutral marker analysis in <xref ref-type="fig" rid="F3">Figure&#x20;3</xref>. Those sequences are included in <xref ref-type="sec" rid="s10">Supplementary Table S1</xref>, indicated by double asterisks. Expression levels of all P-like turripeptides identified in transcriptomes relative to the mean expression of HKG in the same transcriptome are shown in <xref ref-type="fig" rid="F5">Figure&#x20;5C</xref> and provide potential insight into the functional role of each peptide within a species. The species assigned to the genus <italic>Turris sensu lato</italic> for which a transcriptome was obtained and analyzed in this work are shown in <xref ref-type="fig" rid="F1">Figure&#x20;1</xref>.</p>
<p>In addition to venom peptide genes, transcriptomic analysis also provides sequences for all of the other genes expressed in the venom glands, such as housekeeping genes and genes involved in the normal cellular processes required to produce the venom components (i.e.,&#x20;proteins involved in secretion and membrane trafficking). This sequence information was used to carry out a &#x201c;neutral&#x201d; phylogenetic analysis of the species that are simultaneously being analyzed for the identity of venom components. Thus, transcriptomic analysis leads to the easy identification of peptide families from a particular lineage of venomous animals, provides neutral estimates of the phylogenetic relationships between the species being analyzed, and establishes a robust basis for the relationship of that species group to other taxa for which similar transcriptomic data are available. The results of the phylogenetic analyses of the species shown in <xref ref-type="fig" rid="F1">Figures 1</xref>, <xref ref-type="fig" rid="F2">2</xref> are discussed in the following section; the relationship of the species in <xref ref-type="fig" rid="F1">Figure&#x20;1</xref> to other conoideans was assessed, using transcriptomic information from the genera illustrated in <xref ref-type="fig" rid="F2">Figure&#x20;2</xref>.</p>
</sec>
<sec id="s3-3">
<title>Phylogeny of Turrids</title>
<p>The phylogenetic tree in <xref ref-type="fig" rid="F3">Figure&#x20;3</xref>, which was constructed using the transcriptomic approach described under Methods, includes four different conoidean families; all family assignments are firmly supported. The family Terebridae includes two genera, <italic>Terebra</italic>, represented by <italic>Terebra subulata</italic> and <italic>Terebra guttata,</italic> and <italic>Hastula</italic>, including <italic>Hastula nitida</italic> and <italic>Hastula matheroniana</italic>, that define two subbranches on the tree. Similarly, the family Drilliidae is represented by <italic>Drillia</italic> and <italic>Clavus</italic>, and the three genera in Conidae; <italic>Californiconus</italic> (<italic>Conus californicus</italic>), <italic>Conasprella</italic> and <italic>Conus,</italic> are well-supported in this phylogenetic analysis. Thus, the approach used is consistent with present generic assignments in the families Clavidae, Terebridae and Conidae (<xref ref-type="bibr" rid="B3">Bouchet et&#x20;al., 2011</xref>).</p>
<p>In the family Turridae, species conventionally assigned to the genus <italic>Turris</italic> (shown in <xref ref-type="fig" rid="F1">Figure&#x20;1</xref>) are split between two major branches of the family, with most species analyzed remaining in <italic>Turris</italic>, but some conventionally assigned to <italic>Turris</italic> have proven to be only distantly related. We have proposed a new genus, <italic>Purpuraturris gen. nov.</italic> (see the <xref ref-type="other" rid="app1">Appendix 1</xref> and <xref ref-type="fig" rid="F3">Figures 3</xref>, <xref ref-type="fig" rid="F4">4</xref>). The problem of proper generic assignments does not apply only to <italic>Turris</italic>, but also to other major genera in Turridae, such as <italic>Gemmula</italic> which could be addressed using similar methodologies in the future.</p>
</sec>
<sec id="s3-4">
<title>A Biological Framework for Venom Peptide Libraries</title>
<p>Linking primary amino acid sequences of venom peptides to the phylogeny of the animals in which they evolved is a prerequisite for integrating the biochemical and molecular information obtained from the standard approach used in venom peptide research with the broader biology (and even ecology) of the venomous animals that evolved that library of peptides. The phylogenetic correlation provided for the P-like turripeptides in <xref ref-type="fig" rid="F5">Figure&#x20;5</xref> illustrates a strategy for the further definition and characterization of these peptides. We have shown that there are four major groups of peptides based on sequence similarities, one found in those species that we have moved to the new genus, <italic>Purpuraturris gen. nov.</italic>, and three found in species that remain within the genus <italic>Turris</italic>. The presence of the venom peptides found in <italic>Purpuraturris</italic> species but not in any <italic>Turris</italic> may suggest that these play a role in aspects of <italic>Purpuraturris</italic> biology divergent from the biology of true <italic>Turris</italic> species. The three divergent branches of the tree found in species of <italic>Turris sensu stricto</italic> in turn, suggests that these may play a functional role exclusive to the biology of members of that&#x20;genus.</p>
<p>While we cannot definitively conclude that clade II P-like turripeptides are without exception absent from <italic>Turris</italic> species, nor that clade III and IV P-like turripeptides are universally absent from <italic>Purpuraturris</italic> species, by differentiating the bioactivity of a P-like turripeptide representative from each branch of the phylogenetic tree in <xref ref-type="fig" rid="F5">Figure&#x20;5</xref>, an understanding of the differences in underlying molecular mechanisms can be achieved more efficiently. A correlation of the bioactivity of the various peptides with the biology of the snails that evolved these venom peptides helps to build a foundation for understanding how a peptide in a particular venom contributes to the biology of that species. Furthermore, details of the effects of the peptide on a target animal (presumably prey, predator or competitor) can connect molecular mechanisms to the systems level and behavior. The distribution of homologous peptides across a particular lineage, in this case, the species in the genus <italic>Turris</italic>, will suggest whether that specific venom peptide is involved in a biological strategy shared widely across the genus <italic>Turris</italic> by many species, or whether a particular type of peptide represents an innovative facet of a subset of species in that lineage. Behavioral observations of the species in a particular lineage may then be correlated with particular venom peptides. For example, phylogenetic analysis of A-superfamily toxins from fish-hunting cone snails revealed that distinct clades of toxins correlate with distinct subtype selectivity profiles at the nicotinic acetylcholine receptor (nAChR) (<xref ref-type="bibr" rid="B34">Puillandre et&#x20;al., 2010</xref>).</p>
</sec>
<sec id="s3-5">
<title>Selection of Venom Peptides for Biological Characterization</title>
<p>The assessment of which peptides in a large venom peptide library should be selected for further analysis can be viewed as a three-step process. The first step is to obtain the library of venom peptide sequences from a lineage of related venomous animals, in this study, the species conventionally assigned to a single genus, <italic>Turris</italic>. The phylogenetic analysis revealed that a group of four species were not congeneric, but in fact, were only distantly related to species correctly assigned to <italic>Turris</italic>. By carrying out the analysis of both groups of species and analyzing the peptide sequences obtained, peptides more closely related to each other could be grouped into discrete clusters. Each cluster likely represents a different underlying mechanism for bioactivity, and analyzing at least one representative of each cluster would be a priority&#x20;goal.</p>
<p>Some clusters however, are represented by multiple peptides even within the venom of a single species; these may have related molecular targets. If the potential macromolecular targets are of high interest, it may be desirable to investigate the subgroups within each cluster of related peptides. Investigation of dissimilar peptides based on branch lengths in the venom peptide phylogenetic tree may also help prioritize the selection peptides likely to have differences in their bioactivities. This initial phase of analysis is based purely on the peptide sequences initially obtained. Additional input data for developing an experimental strategy are the level of expression of peptides that define a particular cluster and the ability to carry out a thorough proteomic analysis so that the native venom peptide can be compared as comprehensively as possible with a peptide that is either synthesized chemically or produced through recombinant expression. In the case of conoidean venom peptide libraries, this is particularly important because of the frequent presence of posttranslational modifications.</p>
<p>An additional consideration for which peptides to characterize is which venom can be obtained in greater quantity and without negative ecological impact; in addition to the phylogenetic data and the level of expression derived from the transcriptomic data, a proteomic analysis confers significant advantages, and this generally requires a larger venom sample than is required for the other assessments. Thus, in the Thd9.1 cluster, whether it should be the peptide from <italic>T. hidalgoi</italic> or from <italic>T. spectabilis</italic> that is investigated depends on which venom is more easily available. The more abundant venom can be fractionated using the standard HPLC methods to purify individual peptides, and a mass spectrometric analysis with appropriate proteomic bioinformatics should identify peptides in the crude venom related to the Thd9.1 cluster. This analysis is important because it would uncover any posttranslational modifications, which is essential information required before initiating a comprehensive biochemical characterization. Furthermore, if a sufficient amount of venom were available to purify the native venom peptide in large amounts, after the peptide has been chemically synthesized (or produced by recombinant methods), a thorough comparison between the synthetic and the native peptides can be carried out, both with respect to biochemical identity, as well as to demonstrate similar bioactivity. These experiments are greatly facilitated by having larger amounts of native material readily available.</p>
<p>Thus, even before any biochemical work is initiated, the venom peptide library can be better assessed if the following were available: 1. A phylogeny of species in the lineage from which the peptide library was obtained. 2. A tree clustering individual members of the library into groups in order to assess their relatedness, 3. The level of expression of each venom peptide in the library. 4. A proteomic analysis of the venom to identify post-translational modifications and proteolytic cleavage sites, 5. Purified native peptide from venom for subsequent structural and functional comparison to a synthetic analog. Together, these can be used to prioritize which specific peptides will be the leads for chemical synthesis and biological characterization. Assembling these data leads to an informed decision of which peptides in the venom peptide library should be investigated. Since the characterization of each individual peptide is a major commitment of time and resources, this is a key decision&#x20;point.</p>
<p>Once a significant quantity of the authentic bioactive peptide becomes available, either through chemical synthesis or recombinant expression, assessing potential biomedical applications can then be initiated. Several major factors influence how this assessment should be carried out: which biomedical applications are of the highest priority to the researchers (e.g., cancer applications, pain, neurodegenerative disease), what range of relevant assays are accessible, and the quantity of peptide available for the initial characterization. Since these factors vary considerably, which peptides to focus on for biomedical applications such as drug development will clearly be dictated by the results of the initial characterization. Venom peptides that have a novel activity and that score on an assay that has relevance for specific biomedical applications could then be prioritized for further comprehensive characterization and assessment.</p>
</sec>
</sec>
<sec sec-type="methods" id="s4">
<title>Methods</title>
<sec id="s4-1">
<title>Cloning and sequencing of cDNA Clones Encoding <italic>Turris normandavidsoni</italic> PII and PIII Turripeptide Sequences</title>
<p>RNA isolation and cDNA synthesis were performed as previously described for <italic>Iotyrris olangoensis</italic> (<xref ref-type="bibr" rid="B42">Watkins et&#x20;al., 2006</xref>). First strand cDNA from <italic>Turris normandavidsoni</italic> was used as template to amplify the genes encoding PII and PIII turripeptides. Oligonucleotide primers were designed from untranslated region sequences flanking the open reading frame of PII turripeptide-encoding clones identified from <italic>Iotyrris olangoensis</italic> (<xref ref-type="bibr" rid="B42">Watkins et&#x20;al., 2006</xref>) cDNA to amplify PII turripeptide sequences from <italic>Turris normandavidsoni</italic> (Tnr9.2; <xref ref-type="table" rid="T1">Table&#x20;1</xref>, <xref ref-type="sec" rid="s10">Supplementary Table S1</xref>): 5&#x2019; (GAA CCR GCC AGC RAG ATG GG) and 3&#x2019; (GCC ATC AGT TGA CAA CAC GTG). Primers to the signal sequence and 3&#x2032;UTR regions of PIII turripeptide-encoding genes identified from <italic>Iotyrris olangoensis</italic> (<xref ref-type="bibr" rid="B42">Watkins et&#x20;al., 2006</xref>) were used to amplify PIII turritoxin sequences from <italic>Turris normandavidsoni</italic> (Tn9.3 and Tnr9.4; <xref ref-type="table" rid="T1">Table&#x20;1</xref>, <xref ref-type="sec" rid="s10">Supplementary Table S1</xref>): 5&#x2019; (GAA CCR GCC AGC RAG) and 3&#x2019; (GCC ATC AGT TGA CAA CAC GTG). Polymerase chain reactions were performed with Advantage 2 polymerase Mix as described for mitochondrial gene products. The PCR cycling profiles are as follows: Initial denaturation (95&#xb0;C, 60s); followed by 40 cycles of denaturation (95&#xb0;C, 20s); annealing (58&#xb0;C, 20s) and extension (72&#xb0;C,&#x20;30s).</p>
<p>The resulting PCR products were purified, annealed to pNEB206A vector and transformed into competent cells, as described for mitochondrial gene products.</p>
<p>The nucleic acid sequences of these PII and PIII turritoxin-encoding clones were determined by automated sequencing (Core Sequencing Facility, University of Utah, United&#x20;States).</p>
</sec>
<sec id="s4-2">
<title>Transcriptome Based Phylogeny</title>
<p>Venom gland transcriptomes were generated as previously described (<xref ref-type="bibr" rid="B22">Li et&#x20;al., 2018</xref>). Briefly, adapter clipping and quality trimming of raw reads were performed using fqtrim software (Version 0.9.4, <ext-link ext-link-type="uri" xlink:href="http://ccb.jhu.edu/software/fqtrim/">http://ccb.jhu.edu/software/fqtrim/</ext-link>) and PRINSEQ (Version 0.20.4) (<xref ref-type="bibr" rid="B38">Schmieder and Edwards, 2011</xref>). After processing, sequences shorter than 70 bps and those containing more than 5% ambiguous bases (Ns) were discarded. De novo transcriptome assembly was performed using Trinity Version 2.0.5 (<xref ref-type="bibr" rid="B7">Grabherr et&#x20;al., 2011</xref>) with a kmer size for building De Bruijn Graphs of 31, a minimum kmer coverage of 10, and a minimum glue of 10. Assembled transcripts were annotated using Blastx [(NCBI-Blast-2.2.28&#x2b;, (<xref ref-type="bibr" rid="B2">Altschul et&#x20;al., 1990</xref>)] against conotoxin sequences extracted from the ConoServer (<xref ref-type="bibr" rid="B13">Kaas et&#x20;al., 2008</xref>) and (<xref ref-type="bibr" rid="B40">UniProt Consortium, 2015</xref>). The species, number of transcripts, toxins identified, toxin transcript expression values (tpm) and the number of toxin superfamilies identified in each of the 35 transcriptomes used here are listed in <xref ref-type="sec" rid="s10">Supplementary Table S3</xref>. These transcriptomes were assessed using BUSCO analysis (busco:v5.2.2_cv2) (<xref ref-type="bibr" rid="B24">Manni et&#x20;al., 2021</xref>) with the database mollusca_odb10 (5295 entries) and found to be of comparable quality (<xref ref-type="sec" rid="s10">Supplementary Table S3</xref>). Common genes that were shared between all samples were identified using the blast identities of assembled contigs (e &#x3c; 10<sup>&#x2013;4</sup>). This set of 66 housekeeping genes (HKG), half of which are ribosomal genes, is listed in <xref ref-type="sec" rid="s10">Supplementary Table S4</xref>, along with Uniprot accession numbers. For each HKG, we aligned the nucleotide sequences from all species using mafft v7.407 (<xref ref-type="bibr" rid="B16">Katoh et&#x20;al., 2005</xref>) (with the &#x201c;auto&#x201d; flag). For each alignment file we used the RAxML v8.2.12 (<xref ref-type="bibr" rid="B39">Stamatakis, 2006</xref>) program with a GTRGAMMA model (unpartitioned) to determine the &#x201c;best&#x201d; tree. Finally, we used Astral (version 5.7.3) (<xref ref-type="bibr" rid="B43">Zhang et&#x20;al., 2018</xref>) to generate a consensus tree from all the individual single-gene trees. The HKG dataset generated for this study is included in the DRYAD repository (DOI): <ext-link ext-link-type="uri" xlink:href="doi:10.5061/dryad.ksn02v751">doi:10.5061/dryad.ksn02v751</ext-link>) as fasta files, aligned nt mafft fasta files and newick formatted &#x201c;best&#x201d;&#x20;trees.</p>
<p>The identities of the turrid specimens used for transcriptome-based phylogeny were confirmed using the COI barcode sequence, in the same manner as described in Methods for standard phylogeny. These GenBank accession numbers are listed in <xref ref-type="sec" rid="s10">Supplementary Table S2</xref> and are consistent with the COI barcode sequences generated for <xref ref-type="fig" rid="F4">Figure&#x20;4</xref> and listed in <xref ref-type="sec" rid="s10">Supplementary Table&#x20;S5</xref>.</p>
</sec>
<sec id="s4-3">
<title>Phylogenetic Analysis of Turrid Species Using Standard Molecular Markers</title>
<p>Phylogenetic analysis was performed using concatenated 12S and 16S rRNA and the mitochondrial cytochrome oxidase I (COI) barcode sequences for each species as previously described (<xref ref-type="bibr" rid="B46">Nam et&#x20;al., 2009</xref>, <xref ref-type="bibr" rid="B32">Puillandre et&#x20;al., 2014</xref>). GenBank accession numbers for these standard phylogenetic markers, which were used to generate <xref ref-type="fig" rid="F4">Figure&#x20;4</xref>, are listed in <xref ref-type="sec" rid="s10">Supplementary Table&#x20;S5</xref>.</p>
<p>Multiple sequence alignment was performed using MAFFT version 7 (RRID:SCR_011811) (<xref ref-type="bibr" rid="B17">Katoh et&#x20;al., 2017</xref>), maximum likelihood tree reconstruction was performed using IQ tree (RRID:SCR_021163) (<xref ref-type="bibr" rid="B28">Nguyen et&#x20;al., 2015</xref>), consisting of best-fit model TVM&#x002B;F&#x002B;I&#x002B;G4 using ModelFinder (<xref ref-type="bibr" rid="B15">Kalyaanamoorthy et&#x20;al., 2017</xref>) and ultrafast bootstrap approximation (<xref ref-type="bibr" rid="B26">Minh et&#x20;al., 2013</xref>) and the tree was visualized using iTOL version 6.4 (RRID:SCR_018174) (<xref ref-type="bibr" rid="B19">Letunic and Bork, 2021</xref>). The alignment file has been included in the supplementary data as <xref ref-type="sec" rid="s10">Supplementary Data Sheet&#x20;S1</xref>.</p>
</sec>
<sec id="s4-4">
<title>Phylogenetic Analysis of P-like Turritoxins</title>
<p>The sequences of the P-type turripeptide precursors were aligned using the MAFFT multiple sequence alignment program (RRID:SCR_011811) (<ext-link ext-link-type="uri" xlink:href="http://wasabi.org">wasabi.org</ext-link>) (<xref ref-type="bibr" rid="B41">Veidenberg et al., 2015</xref>) and refined by eye. Phylogenetic analysis was performed using IQ tree (RRID:SCR_021163) (<xref ref-type="bibr" rid="B28">Nguyen et&#x20;al., 2015</xref>), consisting of best-fit model JTTDCMut&#x2b;G4 using ModelFinder (<xref ref-type="bibr" rid="B15">Kalyaanamoorthy et&#x20;al., 2017</xref>) and ultrafast bootstrap approximation (<xref ref-type="bibr" rid="B26">Minh et&#x20;al., 2013</xref>) and the tree was visualized using iTOL version 6.4 (RRID:SCR_018174) (<xref ref-type="bibr" rid="B19">Letunic and Bork, 2021</xref>). The phylogenetic tree, which is rooted at the midpoint, is shown in <xref ref-type="fig" rid="F5">Figure&#x20;5A</xref>. The alignment has been included in <xref ref-type="fig" rid="F5">Figure&#x20;5B</xref>. Complete peptide precursors are shown in <xref ref-type="sec" rid="s10">Supplementary Table S1</xref>, predicted mature peptides are shown in <xref ref-type="table" rid="T1">Table&#x20;1</xref>, and relative expression levels, where available, are shown in <xref ref-type="fig" rid="F5">Figure&#x20;5C</xref>. The sequences were deposited into the GenBank nucleotide database, accession numbers: OK247621-OK247652.</p>
</sec>
</sec>
</body>
<back>
<sec id="s5">
<title>Data Availability Statement</title>
<p>Phylogenetic sequences used in this study have been deposited in GenBank with the indicated accession numbers listed in <xref ref-type="sec" rid="s10">Supplementary Tables 2,5</xref>. Peptide precursor sequences have been deposited into the GenBank nucleotide database, accession numbers OK247621-OK247652. HKG gene sequences obtained from transcriptome data have been included in Dryad: Chase, Kevin; Watkins, Maren (2021), Integrating Venom Peptide Libraries into a Phylogenetic and Broader Biological Framework, Dryad, Dataset, <ext-link ext-link-type="uri" xlink:href="https://doi.org/10.5061/dryad.ksn02v751">https://doi.org/10.5061/dryad.ksn02v751</ext-link>.</p>
</sec>
<sec id="s6">
<title>Author Contributions</title>
<p>KC designed the HGK study and performed transcriptome and statistical analysis. MW performed phylogenetic analysis and toxin identification. BO, MW and KC wrote the manuscript. BO, MW, HS-H and KC reviewed and edited the manuscript. All authors have read and agreed to the published version of the manuscript.</p>
</sec>
<sec id="s7">
<title>Funding</title>
<p>This work was in part supported by National Institute of General Medical Science grants (P01GM048677 and R01GM122869 to BO) and by DoD W81XWH-17-1-0413 to BO. HS-H acknowledges fellowship support from the Villum Foundation (19063).</p>
</sec>
<sec sec-type="COI-statement" id="s8">
<title>Conflict of Interest</title>
<p>The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.</p>
</sec>
<sec sec-type="disclaimer" id="s9">
<title>Publisher&#x2019;s Note</title>
<p>All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.</p>
</sec>
<ack>
<p>We thank Samuel Espino for the photographs of the shells in this manuscript. We would like to acknowledge that this work could not have been carried out without the contributions of the field collectors, and our colleagues in the Philippines, including Gisela Concepcion, Noel Saguil and Meljune Chicote. We are very grateful for Julita Imperial&#x2019;s help in organizing the venom duct collection and other material that was the basis for this work. We thank the High Throughput Genomics Core Facility, the DNA Sequencing Core Facility.</p>
</ack>
<sec id="s10">
<title>Supplementary Material</title>
<p>The Supplementary Material for this article can be found online at: <ext-link ext-link-type="uri" xlink:href="https://www.frontiersin.org/articles/10.3389/fmolb.2022.784419/full#supplementary-material">https://www.frontiersin.org/articles/10.3389/fmolb.2022.784419/full&#x23;supplementary-material</ext-link>
</p>
<supplementary-material xlink:href="Table1.DOCX" id="SM1" mimetype="application/DOCX" xmlns:xlink="http://www.w3.org/1999/xlink"/>
<supplementary-material xlink:href="DataSheet3.xlsx" id="SM2" mimetype="application/xlsx" xmlns:xlink="http://www.w3.org/1999/xlink"/>
<supplementary-material xlink:href="Table2.DOCX" id="SM3" mimetype="application/DOCX" xmlns:xlink="http://www.w3.org/1999/xlink"/>
<supplementary-material xlink:href="Table3.docx" id="SM4" mimetype="application/docx" xmlns:xlink="http://www.w3.org/1999/xlink"/>
<supplementary-material xlink:href="DataSheet1.FASTA" id="SM5" mimetype="application/FASTA" xmlns:xlink="http://www.w3.org/1999/xlink"/>
<supplementary-material xlink:href="DataSheet2.xlsx" id="SM6" mimetype="application/xlsx" xmlns:xlink="http://www.w3.org/1999/xlink"/>
</sec>
<ref-list>
<title>References</title>
<ref id="B1">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Abdelkrim</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Aznar-Cormano</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Buge</surname>
<given-names>B.</given-names>
</name>
<name>
<surname>Fedosov</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Kantor</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Zaharias</surname>
<given-names>P.</given-names>
</name>
<etal/>
</person-group> (<year>2018</year>). <article-title>Delimiting Species of marine Gastropods (Turridae, Conoidea) Using RAD Sequencing in an Integrative Taxonomy Framework</article-title>. <source>Mol. Ecol.</source> <volume>27</volume> (<issue>22</issue>), <fpage>4591</fpage>&#x2013;<lpage>4611</lpage>. <pub-id pub-id-type="doi">10.1111/mec.14882</pub-id> </citation>
</ref>
<ref id="B2">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Altschul</surname>
<given-names>S. F.</given-names>
</name>
<name>
<surname>Gish</surname>
<given-names>W.</given-names>
</name>
<name>
<surname>Miller</surname>
<given-names>W.</given-names>
</name>
<name>
<surname>Myers</surname>
<given-names>E. W.</given-names>
</name>
<name>
<surname>Lipman</surname>
<given-names>D. J.</given-names>
</name>
</person-group> (<year>1990</year>). <article-title>Basic Local Alignment Search Tool</article-title>. <source>J.&#x20;Mol. Biol.</source> <volume>215</volume> (<issue>3</issue>), <fpage>403</fpage>&#x2013;<lpage>410</lpage>. <pub-id pub-id-type="doi">10.1016/s0022-2836(05)80360-2</pub-id> </citation>
</ref>
<ref id="B3">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Bouchet</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Kantor</surname>
<given-names>Y. I.</given-names>
</name>
<name>
<surname>Sysoev</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Puillandre</surname>
<given-names>N.</given-names>
</name>
</person-group> (<year>2011</year>). <article-title>A New Operational Classification of the Conoidea (Gastropoda)</article-title>. <source>J.&#x20;Molluscan Stud.</source> <volume>77</volume> (<issue>3</issue>), <fpage>273</fpage>&#x2013;<lpage>308</lpage>. <pub-id pub-id-type="doi">10.1093/mollus/eyr017</pub-id> </citation>
</ref>
<ref id="B4">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Bouchet</surname>
<given-names>P.</given-names>
</name>
</person-group> (<year>1990</year>). <article-title>Turrid Gnera and Mode of Development: the Use and Abuse of Protoconch Morphology</article-title>. <source>Malacologia</source> <volume>32</volume>, <fpage>69</fpage>&#x2013;<lpage>77</lpage>. <ext-link ext-link-type="uri" xlink:href="https://www.biodiversitylibrary.org/page/13146254">https://www.biodiversitylibrary.org/page/13146254</ext-link> </citation>
</ref>
<ref id="B5">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Chen</surname>
<given-names>N.</given-names>
</name>
<name>
<surname>Xu</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Zhang</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Wang</surname>
<given-names>F.</given-names>
</name>
</person-group> (<year>2018</year>). <article-title>Animal Protein Toxins: Origins and Therapeutic Applications</article-title>. <source>Biophys. Rep.</source> <volume>4</volume> (<issue>5</issue>), <fpage>233</fpage>&#x2013;<lpage>242</lpage>. <pub-id pub-id-type="doi">10.1007/s41048-018-0067-x</pub-id> </citation>
</ref>
<ref id="B6">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Fedosov</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Watkins</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Heralde</surname>
<given-names>F. M.</given-names>
</name>
<name>
<surname>Corneli</surname>
<given-names>P. S.</given-names>
</name>
<name>
<surname>Concepcion</surname>
<given-names>G. P.</given-names>
</name>
<name>
<surname>Olivera</surname>
<given-names>B. M.</given-names>
</name>
</person-group> (<year>2011</year>). <article-title>Phylogeny of the Genus Turris: Correlating Molecular Data with Radular Anatomy and Shell Morphology</article-title>. <source>Mol. Phylogenet. Evol.</source> <volume>59</volume> (<issue>2</issue>), <fpage>263</fpage>&#x2013;<lpage>270</lpage>. <pub-id pub-id-type="doi">10.1016/j.ympev.2011.01.019</pub-id> </citation>
</ref>
<ref id="B7">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Grabherr</surname>
<given-names>M. G.</given-names>
</name>
<name>
<surname>Haas</surname>
<given-names>B. J.</given-names>
</name>
<name>
<surname>Yassour</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Levin</surname>
<given-names>J.&#x20;Z.</given-names>
</name>
<name>
<surname>Thompson</surname>
<given-names>D. A.</given-names>
</name>
<name>
<surname>Amit</surname>
<given-names>I.</given-names>
</name>
<etal/>
</person-group> (<year>2011</year>). <article-title>Full-length Transcriptome Assembly from RNA-Seq Data without a Reference Genome</article-title>. <source>Nat. Biotechnol.</source> <volume>29</volume> (<issue>7</issue>), <fpage>644</fpage>&#x2013;<lpage>652</lpage>. <pub-id pub-id-type="doi">10.1038/nbt.1883</pub-id> </citation>
</ref>
<ref id="B8">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Gray</surname>
<given-names>W. R.</given-names>
</name>
<name>
<surname>Olivera</surname>
<given-names>B. M.</given-names>
</name>
<name>
<surname>Cruz</surname>
<given-names>L. J.</given-names>
</name>
</person-group> (<year>1988</year>). <article-title>PEPTIDE TOXINS FROM VENOMOUS CONUS SNAILS</article-title>. <source>Annu. Rev. Biochem.</source> <volume>57</volume> (<issue>1</issue>), <fpage>665</fpage>&#x2013;<lpage>700</lpage>. <pub-id pub-id-type="doi">10.1146/annurev.bi.57.070188.003313</pub-id> </citation>
</ref>
<ref id="B9">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Heralde</surname>
<given-names>F. M.</given-names>
<suffix>Iii</suffix>
</name>
<name>
<surname>Imperial</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Bandyopadhyay</surname>
<given-names>P. K.</given-names>
</name>
<name>
<surname>Olivera</surname>
<given-names>B. M.</given-names>
</name>
<name>
<surname>Concepcion</surname>
<given-names>G. P.</given-names>
</name>
<name>
<surname>Santos</surname>
<given-names>A. D.</given-names>
</name>
</person-group> (<year>2008</year>). <article-title>A Rapidly Diverging Superfamily of Peptide Toxins in Venomous Gemmula Species</article-title>. <source>Toxicon</source> <volume>51</volume> (<issue>5</issue>), <fpage>890</fpage>&#x2013;<lpage>897</lpage>. <pub-id pub-id-type="doi">10.1016/j.toxicon.2007.12.022</pub-id> </citation>
</ref>
<ref id="B10">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Holford</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Puillandre</surname>
<given-names>N.</given-names>
</name>
<name>
<surname>Modica</surname>
<given-names>M. V.</given-names>
</name>
<name>
<surname>Watkins</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Collin</surname>
<given-names>R.</given-names>
</name>
<name>
<surname>Bermingham</surname>
<given-names>E.</given-names>
</name>
<etal/>
</person-group> (<year>2009</year>). <article-title>Correlating Molecular Phylogeny with Venom Apparatus Occurrence in Panamic Auger Snails (Terebridae)</article-title>. <source>PLOS ONE</source> <volume>4</volume> (<issue>11</issue>), <fpage>e7667</fpage>. <pub-id pub-id-type="doi">10.1371/journal.pone.0007667</pub-id> </citation>
</ref>
<ref id="B11">
<citation citation-type="book">
<person-group person-group-type="author">
<name>
<surname>Horton</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>Kroh</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Ahyong</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Bailly</surname>
<given-names>N.</given-names>
</name>
<name>
<surname>Boyko</surname>
<given-names>C. B.</given-names>
</name>
<name>
<surname>Brand&#xe3;o</surname>
<given-names>S. N.</given-names>
</name>
<etal/>
</person-group> (<year>2021</year>). <source>World Register of Marine Species (WoRMS)</source>. <publisher-name>WoRMS Editorial Board</publisher-name>. <comment>Accessed at: <ext-link ext-link-type="uri" xlink:href="https://www.marinespecies.org at VLIZ">https://www.marinespecies.org at VLIZ</ext-link>
</comment>. (<comment>Accessed January 28, 2022</comment>). <pub-id pub-id-type="doi">10.14284/170</pub-id> </citation>
</ref>
<ref id="B12">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Kaas</surname>
<given-names>Q.</given-names>
</name>
<name>
<surname>Westermann</surname>
<given-names>J.&#x20;C.</given-names>
</name>
<name>
<surname>Craik</surname>
<given-names>D. J.</given-names>
</name>
</person-group> (<year>2010</year>). <article-title>Conopeptide Characterization and Classifications: An Analysis Using ConoServer</article-title>. <source>Toxicon</source> <volume>55</volume> (<issue>8</issue>), <fpage>1491</fpage>&#x2013;<lpage>1509</lpage>. <pub-id pub-id-type="doi">10.1016/j.toxicon.2010.03.002</pub-id> </citation>
</ref>
<ref id="B13">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Kaas</surname>
<given-names>Q.</given-names>
</name>
<name>
<surname>Westermann</surname>
<given-names>J.-C.</given-names>
</name>
<name>
<surname>Halai</surname>
<given-names>R.</given-names>
</name>
<name>
<surname>Wang</surname>
<given-names>C. K. L.</given-names>
</name>
<name>
<surname>Craik</surname>
<given-names>D. J.</given-names>
</name>
</person-group> (<year>2008</year>). <article-title>ConoServer, a Database for Conopeptide Sequences and Structures</article-title>. <source>Bioinformatics</source> <volume>24</volume> (<issue>3</issue>), <fpage>445</fpage>&#x2013;<lpage>446</lpage>. <pub-id pub-id-type="doi">10.1093/bioinformatics/btm596</pub-id> </citation>
</ref>
<ref id="B14">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Kaas</surname>
<given-names>Q.</given-names>
</name>
<name>
<surname>Yu</surname>
<given-names>R.</given-names>
</name>
<name>
<surname>Jin</surname>
<given-names>A.-H.</given-names>
</name>
<name>
<surname>Dutertre</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Craik</surname>
<given-names>D. J.</given-names>
</name>
</person-group> (<year>2012</year>). <article-title>ConoServer: Updated Content, Knowledge, and Discovery Tools in the Conopeptide Database</article-title>. <source>Nucleic Acids Res.</source> <volume>40</volume>, <fpage>D325</fpage>&#x2013;<lpage>D330</lpage>. <pub-id pub-id-type="doi">10.1093/nar/gkr886</pub-id> </citation>
</ref>
<ref id="B15">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Kalyaanamoorthy</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Minh</surname>
<given-names>B. Q.</given-names>
</name>
<name>
<surname>Wong</surname>
<given-names>T. K. F.</given-names>
</name>
<name>
<surname>von Haeseler</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Jermiin</surname>
<given-names>L. S.</given-names>
</name>
</person-group> (<year>2017</year>). <article-title>ModelFinder: Fast Model Selection for Accurate Phylogenetic Estimates</article-title>. <source>Nat. Methods</source> <volume>14</volume> (<issue>6</issue>), <fpage>587</fpage>&#x2013;<lpage>589</lpage>. <pub-id pub-id-type="doi">10.1038/nmeth.4285</pub-id> </citation>
</ref>
<ref id="B16">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Katoh</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Kuma</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Toh</surname>
<given-names>H.</given-names>
</name>
<name>
<surname>Miyata</surname>
<given-names>T.</given-names>
</name>
</person-group> (<year>2005</year>). <article-title>MAFFT Version 5: Improvement in Accuracy of Multiple Sequence Alignment</article-title>. <source>Nucleic Acids Res.</source> <volume>33</volume> (<issue>2</issue>), <fpage>511</fpage>&#x2013;<lpage>518</lpage>. <pub-id pub-id-type="doi">10.1093/nar/gki198</pub-id> </citation>
</ref>
<ref id="B17">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Katoh</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Rozewicki</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Yamada</surname>
<given-names>K. D.</given-names>
</name>
</person-group> (<year>2017</year>). <article-title>MAFFT Online Service: Multiple Sequence Alignment, Interactive Sequence Choice and Visualization</article-title>. <source>Brief. Bioinform.</source> <volume>20</volume> (<issue>4</issue>), <fpage>1160</fpage>&#x2013;<lpage>1166</lpage>. <pub-id pub-id-type="doi">10.1093/bib/bbx108</pub-id> </citation>
</ref>
<ref id="B44">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Kilburn</surname>
<given-names>R. N.</given-names>
</name>
<name>
<surname>Fedosov</surname>
<given-names>A. E.</given-names>
</name>
<name>
<surname>Olivera</surname>
<given-names>B. M.</given-names>
</name>
</person-group> (<year>2012</year>). <article-title>Revision of the Genus <italic>Turris</italic> (Gastropoda: Conoidea: Turridae) with the Description of Six New Species</article-title>. <source>Zootaxa</source> <volume>3244</volume> (<issue>1</issue>), <fpage>1</fpage>&#x2013;<lpage>58</lpage>. </citation>
</ref>
<ref id="B18">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>King</surname>
<given-names>G. F.</given-names>
</name>
<name>
<surname>Gentz</surname>
<given-names>M. C.</given-names>
</name>
<name>
<surname>Escoubas</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Nicholson</surname>
<given-names>G. M.</given-names>
</name>
</person-group> (<year>2008</year>). <article-title>A Rational Nomenclature for Naming Peptide Toxins from Spiders and Other Venomous Animals</article-title>. <source>Toxicon</source> <volume>52</volume> (<issue>2</issue>), <fpage>264</fpage>&#x2013;<lpage>276</lpage>. <pub-id pub-id-type="doi">10.1016/j.toxicon.2008.05.020</pub-id> </citation>
</ref>
<ref id="B19">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Letunic</surname>
<given-names>I.</given-names>
</name>
<name>
<surname>Bork</surname>
<given-names>P.</given-names>
</name>
</person-group> (<year>2021</year>). <article-title>Interactive Tree of Life (iTOL) V5: an Online Tool for Phylogenetic Tree Display and Annotation</article-title>. <source>Nucleic Acids Res.</source> <volume>49</volume> (<issue>W1</issue>), <fpage>W293</fpage>&#x2013;<lpage>W296</lpage>. <pub-id pub-id-type="doi">10.1093/nar/gkab301</pub-id> </citation>
</ref>
<ref id="B20">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Lewis</surname>
<given-names>R. J.</given-names>
</name>
<name>
<surname>Garcia</surname>
<given-names>M. L.</given-names>
</name>
</person-group> (<year>2003</year>). <article-title>Therapeutic Potential of Venom Peptides</article-title>. <source>Nat. Rev. Drug Discov.</source> <volume>2</volume> (<issue>10</issue>), <fpage>790</fpage>&#x2013;<lpage>802</lpage>. <pub-id pub-id-type="doi">10.1038/nrd1197</pub-id> </citation>
</ref>
<ref id="B45">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Li</surname>
<given-names>B.</given-names>
</name>
<name>
<surname>Li</surname>
<given-names>X.</given-names>
</name>
</person-group> (<year>2007</year>). <article-title>An Account of the Genus Turris Species (Mollusca: Gastropoda: Turridae) From the East and South China Seas</article-title>. <source>Zootaxa</source> <volume>1397</volume>, <fpage>63</fpage>&#x2013;<lpage>68</lpage>. </citation>
</ref>
<ref id="B21">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Li</surname>
<given-names>Q.</given-names>
</name>
<name>
<surname>Barghi</surname>
<given-names>N.</given-names>
</name>
<name>
<surname>Lu</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Fedosov</surname>
<given-names>A. E.</given-names>
</name>
<name>
<surname>Bandyopadhyay</surname>
<given-names>P. K.</given-names>
</name>
<name>
<surname>Lluisma</surname>
<given-names>A. O.</given-names>
</name>
<etal/>
</person-group> (<year>2017</year>). <article-title>Divergence of the Venom Exogene Repertoire in Two Sister Species of Turriconus</article-title>. <source>Genome Biol. Evol.</source> <volume>9</volume> (<issue>9</issue>), <fpage>2211</fpage>&#x2013;<lpage>2225</lpage>. <pub-id pub-id-type="doi">10.1093/gbe/evx157</pub-id> </citation>
</ref>
<ref id="B22">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Li</surname>
<given-names>Q.</given-names>
</name>
<name>
<surname>Watkins</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Robinson</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Safavi-Hemami</surname>
<given-names>H.</given-names>
</name>
<name>
<surname>Yandell</surname>
<given-names>M.</given-names>
</name>
</person-group> (<year>2018</year>). <article-title>Discovery of Novel Conotoxin Candidates Using Machine Learning</article-title>. <source>Toxins</source> <volume>10</volume> (<issue>12</issue>), <fpage>503</fpage>. <pub-id pub-id-type="doi">10.3390/toxins10120503</pub-id> </citation>
</ref>
<ref id="B23">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Lu</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Watkins</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Li</surname>
<given-names>Q.</given-names>
</name>
<name>
<surname>Robinson</surname>
<given-names>S. D.</given-names>
</name>
<name>
<surname>Concepcion</surname>
<given-names>G. P.</given-names>
</name>
<name>
<surname>Yandell</surname>
<given-names>M.</given-names>
</name>
<etal/>
</person-group> (<year>2020</year>). <article-title>Transcriptomic Profiling Reveals Extraordinary Diversity of Venom Peptides in Unexplored Predatory Gastropods of the Genus Clavus</article-title>. <source>Genome Biol. Evol.</source> <volume>12</volume> (<issue>5</issue>), <fpage>684</fpage>&#x2013;<lpage>700</lpage>. <pub-id pub-id-type="doi">10.1093/gbe/evaa083</pub-id> </citation>
</ref>
<ref id="B24">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Manni</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Berkeley</surname>
<given-names>M. R.</given-names>
</name>
<name>
<surname>Seppey</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Sim&#xe3;o</surname>
<given-names>F. A.</given-names>
</name>
<name>
<surname>Zdobnov</surname>
<given-names>E. M.</given-names>
</name>
</person-group> (<year>2021</year>). <article-title>BUSCO Update: Novel and Streamlined Workflows along with Broader and Deeper Phylogenetic Coverage for Scoring of Eukaryotic, Prokaryotic, and Viral Genomes</article-title>. <source>Mol. Biol. Evol.</source> <volume>38</volume> (<issue>10</issue>), <fpage>4647</fpage>&#x2013;<lpage>4654</lpage>. <pub-id pub-id-type="doi">10.1093/molbev/msab199</pub-id> </citation>
</ref>
<ref id="B25">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>McIntosh</surname>
<given-names>J.&#x20;M.</given-names>
</name>
<name>
<surname>Santos</surname>
<given-names>A. D.</given-names>
</name>
<name>
<surname>Olivera</surname>
<given-names>B. M.</given-names>
</name>
</person-group> (<year>1999</year>). <article-title>Conus Peptides Targeted to Specific Nicotinic Acetylcholine Receptor Subtypes</article-title>. <source>Annu. Rev. Biochem.</source> <volume>68</volume> (<issue>1</issue>), <fpage>59</fpage>&#x2013;<lpage>88</lpage>. <pub-id pub-id-type="doi">10.1146/annurev.biochem.68.1.59</pub-id> </citation>
</ref>
<ref id="B26">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Minh</surname>
<given-names>B. Q.</given-names>
</name>
<name>
<surname>Nguyen</surname>
<given-names>M. A. T.</given-names>
</name>
<name>
<surname>von Haeseler</surname>
<given-names>A.</given-names>
</name>
</person-group> (<year>2013</year>). <article-title>Ultrafast Approximation for Phylogenetic Bootstrap</article-title>. <source>Mol. Biol. Evol.</source> <volume>30</volume> (<issue>5</issue>), <fpage>1188</fpage>&#x2013;<lpage>1195</lpage>. <pub-id pub-id-type="doi">10.1093/molbev/mst024</pub-id> </citation>
</ref>
<ref id="B27">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>M&#xf6;ller</surname>
<given-names>C.</given-names>
</name>
<name>
<surname>Rahmankhah</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Lauer-Fields</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Bubis</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Fields</surname>
<given-names>G. B.</given-names>
</name>
<name>
<surname>Mar&#xed;</surname>
<given-names>F.</given-names>
</name>
</person-group> (<year>2005</year>). <article-title>A Novel Conotoxin Framework with a Helix&#x2212;Loop&#x2212;Helix (Cs &#x3b1;/&#x3b1;) Fold</article-title>. <source>Biochemistry</source> <volume>44</volume> (<issue>49</issue>), <fpage>15986</fpage>&#x2013;<lpage>15996</lpage>. <pub-id pub-id-type="doi">10.1021/bi0511181</pub-id> </citation>
</ref>
<ref id="B46">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Nam</surname>
<given-names>H. H.</given-names>
</name>
<name>
<surname>Corneli</surname>
<given-names>P. S.</given-names>
</name>
<name>
<surname>Watkins</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Olivera</surname>
<given-names>B.</given-names>
</name>
<name>
<surname>Bandyopadhyay</surname>
<given-names>P.</given-names>
</name>
</person-group> (<year>2009</year>). <article-title>Multiple Genes Elucidate the Evolution of Venomous Snail-Hunting Conus Species</article-title>. <source>Mol. Phylogenet. Evol.</source> <volume>53</volume> (<issue>3</issue>), <fpage>645</fpage>&#x2013;<lpage>652</lpage>. <pub-id pub-id-type="doi">10.1016/j.ympev.2009.07.013</pub-id> </citation>
</ref>
<ref id="B28">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Nguyen</surname>
<given-names>L.-T.</given-names>
</name>
<name>
<surname>Schmidt</surname>
<given-names>H. A.</given-names>
</name>
<name>
<surname>von Haeseler</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Minh</surname>
<given-names>B. Q.</given-names>
</name>
</person-group> (<year>2015</year>). <article-title>IQ-TREE: a Fast and Effective Stochastic Algorithm for Estimating Maximum-Likelihood Phylogenies</article-title>. <source>Mol. Biol. Evol.</source> <volume>32</volume> (<issue>1</issue>), <fpage>268</fpage>&#x2013;<lpage>274</lpage>. <pub-id pub-id-type="doi">10.1093/molbev/msu300</pub-id> </citation>
</ref>
<ref id="B29">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Olivera</surname>
<given-names>B. M.</given-names>
</name>
<name>
<surname>Seronay</surname>
<given-names>R. A.</given-names>
</name>
<name>
<surname>Fedosov</surname>
<given-names>A. E.</given-names>
</name>
</person-group> (<year>2010</year>). <article-title>Turris Babylonia; Re-evaluation of a Species Complex and Description of Turris Assyria, New Species</article-title>. <source>Philipp Sci. Lett.</source> <volume>3</volume> (<issue>1</issue>), <fpage>20107</fpage>. </citation>
</ref>
<ref id="B30">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Olivera</surname>
<given-names>B. M.</given-names>
</name>
<name>
<surname>Showers Corneli</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Watkins</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Fedosov</surname>
<given-names>A.</given-names>
</name>
</person-group> (<year>2014</year>). <article-title>Biodiversity of Cone Snails and Other Venomous Marine Gastropods: Evolutionary Success through Neuropharmacology</article-title>. <source>Annu. Rev. Anim. Biosci.</source> <volume>2</volume> (<issue>1</issue>), <fpage>487</fpage>&#x2013;<lpage>513</lpage>. <pub-id pub-id-type="doi">10.1146/annurev-animal-022513-114124</pub-id> </citation>
</ref>
<ref id="B31">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Pennington</surname>
<given-names>M. W.</given-names>
</name>
<name>
<surname>Czerwinski</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Norton</surname>
<given-names>R. S.</given-names>
</name>
</person-group> (<year>2018</year>). <article-title>Peptide Therapeutics from Venom: Current Status and Potential</article-title>. <source>Bioorg. Med. Chem.</source> <volume>26</volume> (<issue>10</issue>), <fpage>2738</fpage>&#x2013;<lpage>2758</lpage>. <pub-id pub-id-type="doi">10.1016/j.bmc.2017.09.029</pub-id> </citation>
</ref>
<ref id="B47">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Powell</surname>
<given-names>A. W. B.</given-names>
</name>
</person-group> (<year>1964</year>). <article-title>The Family Turridae in the Indo-Pacific. Part 1. The Subfamily Turrinae</article-title>. <source>Indo-Pacific Mollusca</source>. <volume>1</volume>, <fpage>227</fpage>&#x2013;<lpage>346</lpage>. </citation>
</ref>
<ref id="B48">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Powell</surname>
<given-names>A. W. B.</given-names>
</name>
</person-group> (<year>1966</year>). <article-title>The Molluscan Families Speightiidae And Turridae. An Evaluation of the Valid Taxa Both Recent and Fossil, With Lists of Characteristic Species</article-title>. <source>Bulletin of the Auckland Institute and Museum</source> <volume>5</volume>, <fpage>1</fpage>&#x2013;<lpage>184</lpage>. </citation>
</ref>
<ref id="B32">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Puillandre</surname>
<given-names>N.</given-names>
</name>
<name>
<surname>Bouchet</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Duda</surname>
<given-names>T. F.</given-names>
<suffix>Jr.</suffix>
</name>
<name>
<surname>Kauferstein</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Kohn</surname>
<given-names>A. J.</given-names>
</name>
<name>
<surname>Olivera</surname>
<given-names>B. M.</given-names>
</name>
<etal/>
</person-group> (<year>2014</year>). <article-title>Molecular Phylogeny and Evolution of the Cone Snails (Gastropoda, Conoidea)</article-title>. <source>Mol. Phylogenet. Evol.</source> <volume>78</volume>, <fpage>290</fpage>&#x2013;<lpage>303</lpage>. <pub-id pub-id-type="doi">10.1016/j.ympev.2014.05.023</pub-id> </citation>
</ref>
<ref id="B33">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Puillandre</surname>
<given-names>N.</given-names>
</name>
<name>
<surname>Samadi</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Boisselier</surname>
<given-names>M.-C.</given-names>
</name>
<name>
<surname>Sysoev</surname>
<given-names>A. V.</given-names>
</name>
<name>
<surname>Kantor</surname>
<given-names>Y. I.</given-names>
</name>
<name>
<surname>Cruaud</surname>
<given-names>C.</given-names>
</name>
<etal/>
</person-group> (<year>2008</year>). <article-title>Starting to Unravel the Toxoglossan Knot: Molecular Phylogeny of the &#x201c;Turrids&#x201d; (Neogastropoda: Conoidea)</article-title>. <source>Mol. Phylogenet. Evol.</source> <volume>47</volume> (<issue>3</issue>), <fpage>1122</fpage>&#x2013;<lpage>1134</lpage>. <pub-id pub-id-type="doi">10.1016/j.ympev.2007.11.007</pub-id> </citation>
</ref>
<ref id="B34">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Puillandre</surname>
<given-names>N.</given-names>
</name>
<name>
<surname>Watkins</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Olivera</surname>
<given-names>B. M.</given-names>
</name>
</person-group> (<year>2010</year>). <article-title>Evolution of Conus Peptide Genes: Duplication and Positive Selection in the A-Superfamily</article-title>. <source>J.&#x20;Mol. Evol.</source> <volume>70</volume> (<issue>2</issue>), <fpage>190</fpage>&#x2013;<lpage>202</lpage>. <pub-id pub-id-type="doi">10.1007/s00239-010-9321-7</pub-id> </citation>
</ref>
<ref id="B35">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Robinson</surname>
<given-names>S. D.</given-names>
</name>
<name>
<surname>Li</surname>
<given-names>Q.</given-names>
</name>
<name>
<surname>Lu</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Bandyopadhyay</surname>
<given-names>P. K.</given-names>
</name>
<name>
<surname>Yandell</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Olivera</surname>
<given-names>B. M.</given-names>
</name>
<etal/>
</person-group> (<year>2017</year>). <article-title>The Venom Repertoire of Conus Gloriamaris (Chemnitz, 1777), the Glory of the Sea</article-title>. <source>Mar. Drugs</source> <volume>15</volume> (<issue>5</issue>), <fpage>145</fpage>. <pub-id pub-id-type="doi">10.3390/md15050145</pub-id> </citation>
</ref>
<ref id="B36">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Robinson</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Norton</surname>
<given-names>R.</given-names>
</name>
</person-group> (<year>2014</year>). <article-title>Conotoxin Gene Superfamilies</article-title>. <source>Mar. Drugs</source> <volume>12</volume> (<issue>12</issue>), <fpage>6058</fpage>&#x2013;<lpage>6101</lpage>. <pub-id pub-id-type="doi">10.3390/md12126058</pub-id> </citation>
</ref>
<ref id="B37">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Safavi-Hemami</surname>
<given-names>H.</given-names>
</name>
<name>
<surname>Lu</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Li</surname>
<given-names>Q.</given-names>
</name>
<name>
<surname>Fedosov</surname>
<given-names>A. E.</given-names>
</name>
<name>
<surname>Biggs</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Showers Corneli</surname>
<given-names>P.</given-names>
</name>
<etal/>
</person-group> (<year>2016</year>). <article-title>Venom Insulins of Cone Snails Diversify Rapidly and Track Prey Taxa</article-title>. <source>Mol. Biol. Evol.</source> <volume>33</volume> (<issue>11</issue>), <fpage>2924</fpage>&#x2013;<lpage>2934</lpage>. <pub-id pub-id-type="doi">10.1093/molbev/msw174</pub-id> </citation>
</ref>
<ref id="B38">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Schmieder</surname>
<given-names>R.</given-names>
</name>
<name>
<surname>Edwards</surname>
<given-names>R.</given-names>
</name>
</person-group> (<year>2011</year>). <article-title>Quality Control and Preprocessing of Metagenomic Datasets</article-title>. <source>Bioinformatics</source> <volume>27</volume> (<issue>6</issue>), <fpage>863</fpage>&#x2013;<lpage>864</lpage>. <pub-id pub-id-type="doi">10.1093/bioinformatics/btr026</pub-id> </citation>
</ref>
<ref id="B39">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Stamatakis</surname>
<given-names>A.</given-names>
</name>
</person-group> (<year>2006</year>). <article-title>RAxML-VI-HPC: Maximum Likelihood-Based Phylogenetic Analyses with Thousands of Taxa and Mixed Models</article-title>. <source>Bioinformatics</source> <volume>22</volume> (<issue>21</issue>), <fpage>2688</fpage>&#x2013;<lpage>2690</lpage>. <pub-id pub-id-type="doi">10.1093/bioinformatics/btl446</pub-id> </citation>
</ref>
<ref id="B40">
<citation citation-type="journal">UniProt Consortium</citation>
<citation citation-type="journal">
<year>2015</year>). <article-title>UniProt: a Hub for Protein Information</article-title>. <source>Nucleic Acids Res.</source> <volume>43</volume> (<issue>Database issue</issue>), <fpage>D204</fpage>&#x2013;<lpage>D212</lpage>. <pub-id pub-id-type="doi">10.1093/nar/gku989</pub-id> </citation>
</ref>
<ref id="B41">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Veidenberg</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Medlar</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>L&#xf6;ytynoja</surname>
<given-names>A.</given-names>
</name>
</person-group> (<year>2015</year>). <article-title>Wasabi: An Integrated Platform for Evolutionary Sequence Analysis and Data Visualization</article-title>. <source>Mol. Biol. Evol.</source> <volume>33</volume> (<issue>4</issue>), <fpage>1126</fpage>&#x2013;<lpage>1130</lpage>. <pub-id pub-id-type="doi">10.1093/molbev/msv333</pub-id> </citation>
</ref>
<ref id="B42">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Watkins</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Hillyard</surname>
<given-names>D. R.</given-names>
</name>
<name>
<surname>Olivera</surname>
<given-names>B. M.</given-names>
</name>
</person-group> (<year>2006</year>). <article-title>Genes Expressed in a Turrid Venom Duct: Divergence and Similarity to Conotoxins</article-title>. <source>J.&#x20;Mol. Evol.</source> <volume>62</volume> (<issue>3</issue>), <fpage>247</fpage>&#x2013;<lpage>256</lpage>. <pub-id pub-id-type="doi">10.1007/s00239-005-0010-x</pub-id> </citation>
</ref>
<ref id="B43">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Zhang</surname>
<given-names>C.</given-names>
</name>
<name>
<surname>Rabiee</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Sayyari</surname>
<given-names>E.</given-names>
</name>
<name>
<surname>Mirarab</surname>
<given-names>S.</given-names>
</name>
</person-group> (<year>2018</year>). <article-title>ASTRAL-III: Polynomial Time Species Tree Reconstruction from Partially Resolved Gene Trees</article-title>. <source>BMC Bioinformatics</source> <volume>19</volume> (<issue>6</issue>), <fpage>153</fpage>. <pub-id pub-id-type="doi">10.1186/s12859-018-2129-y</pub-id> </citation>
</ref>
</ref-list>
<app-group>
<app id="app1">
<title>Appendices</title>
<sec>
<title>Appendix 1</title>
<p>
<bold>
<underline>Redefining Generic Assignments of Species formerly in <italic>Turris</italic>. Description of a new genus.</underline>
</bold> The rationale for proposing a new genus was described in the text; molecular data reveal that a group of species conventionally assigned to the&#x20;genus <italic>Turris</italic> are only distantly related to true <italic>Turris</italic> (<italic>Turris&#x20;babylonia</italic>, type species). Since these species are morphologically distinct from all other taxa in Turridae, creation of a new genus is justified. Because of the considerable phylogenetic divergence from <italic>Turris</italic>, creating a subgenus of the <italic>Turris</italic> was not a viable option. We designate <italic>Purpuraturris cryptorraphe</italic> as the type species of the new genus, <italic>Purpuraturris gen. nov</italic>.</p>
<p>
<bold>
<underline>Shell morphology: differences between</underline> <italic>
<underline>Turris</underline>
</italic> <underline>and</underline> <italic>
<underline>Purpuraturris</underline>
</italic>.</bold> Traditionally, the position of the apertural slit, the thin linear cleft in the margin of the aperture, on the body whorl was used as a definitive character for including species in the genus <italic>Turris</italic>, but the molecular data show that the Turridae with this feature are separable into two groups. A diagnostic difference between the two groups morphologically is the distinctive violet tinge in color of the aperture and spire of <italic>Purpuraturris</italic> spp., which is lacking in all true <italic>Turris</italic> species. A figure of all species formerly assigned to <italic>Turris</italic> that are now reassigned to <italic>Purpuraturris</italic> is shown in <xref ref-type="other" rid="app1">Appendix Figure 1</xref>.</p>
<fig id="F6" position="float">
<label>Appendix Figure 1</label>
<caption>
<p>Species in <italic>Purpuraturris gen. nov. <italic>from left to right:</italic> Purpuraturris cristata<italic>;</italic> Purpuraturris cryptorraphe, <italic>type species;</italic> Purpuraturris omnipurpurata<italic>;</italic> Purpuraturris tanyspira<italic>;</italic> Purpuraturris undosa<italic>;</italic> Purpuraturris nadaensis</italic>. Top row shows dorsal view, bottom row shows the apertural view. The shells were photographed individually and the photographs were cropped to maintain the size of the shells relative to each other. The scale bar represents an approximate length of 1 cm. (Photographed by Samuel Espino.)</p>
</caption>
<graphic xlink:href="fmolb-09-784419-g006.tif"/>
</fig>
<fig id="F7" position="float">
<label>Appendix Figure 2</label>
<caption>
<p>Diverse morphology of specimens assigned to <italic>Purpuraturris nadaensis</italic> and <italic>Purpuraturris undosa</italic>. The figure shows Philippine examples of specimens assigned to either <italic>Purpuraturris nadaensis</italic> or <italic>Purpuraturris undosa</italic>; specimens in the top row were all assigned to <italic>Purpuraturris nadaensis</italic>, and the bottom row to <italic>Purpuraturris undosa</italic>. Note the divergence in morphology, but the overlap between some of the <italic>nadaensis</italic> vs. <italic>undosa</italic> specimens. The figure illustrates the need for a more comprehensive analysis of the morphology of both the shell and other morphological features (e.g., radula), as well as for a molecular analysis of each different morphotype. If specimens from other localities were included, the range of diverse phenotypes would be even greater. The shells were photographed individually and the photographs were cropped to maintain the size of the shells relative to each other. The scale bar represents an approximate length of 1 cm. (Photographed by Samuel Espino.)</p>
</caption>
<graphic xlink:href="fmolb-09-784419-g007.tif"/>
</fig>
<p>We repeat the characterization of the genus <italic>Turris</italic> from Kilburn et al., 2012, and add additional descriptive criteria that exclude the species included by Kilburn et al. in <italic>Turris</italic> that are being transferred to the new genus. The defining morphological features of species in the new genus are provided in the formal description.<list list-type="simple">
<list-item>
<p>
<underline>Genus <italic>Turris</italic>.</underline> (Description modified from Kilburn et al., 2012)</p>
</list-item>
<list-item>
<p>Family TURRIDAE H. &#x26; A. Adams, 1853</p>
</list-item>
<list-item>
<p>
<italic>Turris</italic> Batsch, 1789 &#x2014; Type species (s.d. Dubois &#x26; Bour 2010): <italic>Murex babylonius</italic>, 1758.</p>
</list-item>
<list-item>
<p>Synonym: <italic>Annulaturris</italic> Powell, 1966. Type species (o.d.): <italic>Pleurotoma amicta</italic> E.A. Smith, 1877</p>
</list-item>
</list>
</p>
<p>DESCRIPTION: Shell medium to large (adult length 40-185 mm), fusiform with high spire and long, unnotched siphonal canal; anal sinus a deep slot situated on a ridge immediately above the peripheral keel; sculpture of spiral cords or ridges, sinus cord often crenulated. Usually with brown spots or stripes. Protoconch usually minute and papilliform, of 2-5 whorls, smooth, later whorls usually axially ribbed; in some species large and bulbous, of 1.5-2.0 smooth whorls. Operculum ungulate, typical of Turrinae.</p>
<p>Radula of duplex marginal teeth, varying considerably in shape, sometimes with a quadrate central tooth bearing a small to large median cusp.</p>
<p>
<italic>Turris</italic> is a tropical Indo-West Pacific group. No species of <italic>Turris</italic> occur in the Atlantic Ocean or Mediterranean Sea. The genus <italic>Turris</italic> was distinguished by Powell (1964, 1966) from the very similar genus <italic>Lophiotoma</italic> Casey, 1904, on the basis of the anal sinus being situated on the &#x201c;special&#x201d; spiral cord, not on the peripheral cord as in the latter. This convention is followed here, although this difference hinges solely on the relative strength of the two cords, a character not always clearly defined. We follow Li &#x26; Li (2007) in leaving the status of <italic>Annulaturris</italic> in abeyance, pending more extensive radula and molecular studies.</p>
<p>All species in <italic>Turris</italic> have a white aperture. A number of species with a purplish aperture or canal, which have been conventionally assigned to this genus do not belong in the redefined genus, but in <italic>Purpuraturris gen. nov</italic>.</p>
<p>
<italic>Purpuraturris gen. nov</italic>. &#x2014; Type species, <italic>Turris cryptorrhaphe</italic>.</p>
<p>DESCRIPTION: Shell medium, fusiform with high spire and medium to short siphonal canal; anal sinus immediately above the peripheral keel. Sculpture consisting of spiral cords or ridges, with the apex of cords often with a dark brown line. Aperture and canal tinted with a purplish hue, but the purplish color fades rapidly. In some specimens, both the siphonal canal and adjacent body whorl have a purple tint. Dark brown stripes that cross the spiral cords are present in some species.</p>
<p>
<italic>Purpuraturris</italic> is a tropical group presently known from the Western Pacific to the Indian Ocean.</p>
<p>
<underline>Speciation in</underline> <italic>
<underline>Purpuraturris</underline>
</italic>
<underline>; geographic distribution</underline>. As a group, the species transferred from <italic>Turris</italic> to <italic>Purpuraturris</italic> are deeper and colder water taxa. The best known and most distinctive species is <italic>Purpuraturris cryptorraphe</italic>, which is widely distributed in the Western Pacific. <italic>Purpuraturris cristata</italic> has a massive sutural rib that differentiates it from all other species, a generally higher spire and short siphonal canal. A third distinctive species, which is extremely rare, is <italic>Purpuraturris omnipurpurata</italic>, so far found only in deep water in the Central and Southern Philippines. This species is smaller and more slender with a relatively longer siphonal canal, and spiral ribs usually lined at the apex (similarly to <italic>Purpuraturris cryptorraphe</italic>). A distinctive feature is the absence of markings on any of the spiral ribbons except for the thin brown line at the apex. We believe that specimens assigned to this species that have such markings in their subsutural spiral ribbon are misidentified (in Poppe, Vol. 5, page 582, Plate 1591; specimen &#x23;3 from Olango Island is an authentic <italic>Purpuraturris omnipurpurata</italic> specimen, but the specimen illustrated in &#x23;4 from Balut Island is, in our opinion, a specimen that belongs to the <italic>Purpuraturris nadaensis</italic> complex). This misidentification is not surprising because of the great variation in the specimens assigned to <italic>Purpuraturris nadaensis</italic>, <italic>Purpuraturris undosa</italic> and overlapping in morphology, <italic>Purpuraturris tanyspira</italic>. The last appears to be separated geographically, being from Southeastern Africa, which suggests that it is probably a different taxon, but all three species are variable, and have overlapping morphological features. A much more comprehensive molecular and morphological characterization is required before definitive assignments can be made at the species level &#x2014; some of the variations are shown in <bold>Appendix Figure 2</bold>.</p>
<p>Another unsettled question is the proper placement of a number of species that seem intermediate between <italic>Turris</italic> and <italic>Purpuraturris</italic>, morphologically, and of the species that had been assigned to <italic>Annulaturris</italic>. These are all unresolved issues, but the data obtained in this study clearly separate the species that we have reassigned to <italic>Purpuraturris</italic> from those related to <italic>Turris babylonia</italic>, which properly belong to <italic>Turris sensu stricto</italic>.</p>
</sec>
<sec id="s11">
<title>Appendix 2</title>
<p>The nomenclature adopted for venom peptides in the family Turridae is based on the convention widely used for disulfide-rich cone snail venoms (<xref ref-type="bibr" rid="B8">Gray et al., 1988</xref>; <xref ref-type="bibr" rid="B25">McIntosh et al., 1999</xref>), and one that can generally be adapted for use in all conoidean venoms. A parallel and similar nomenclature has been adopted for spider peptide toxins as well (<xref ref-type="bibr" rid="B18">King et al., 2008</xref>).</p>
<p>The final name assigned to a given peptide is designed to convey the maximum amount of information.</p>
<p>The toxin name begins with a Greek symbol to identify the molecular target, when known, followed by an uppercase letter to indicate species and a lowercase letter to distinguish between two species beginning with the same letter. Moller et al. have suggested a three-letter code for <italic>Conus</italic> due to a lack of unique combinations using only two letters (<xref ref-type="bibr" rid="B27">M&#xf6;ller et al., 2005</xref>). This is followed by a Roman number to indicate the cysteine framework, which is based on the number and arrangement of cysteine residues (<xref ref-type="bibr" rid="B14">Kaas et al., 2012</xref>) and finally an uppercase Arabic number to denote the order of peptide discovery. For example, in the cone snail venom peptides &#x3c9;-Conotoxin GVIA and &#x3b4;-Conotoxin TxVIA, the Greek letters &#x3c9; and &#x3b4; indicate that the first peptide targets voltage-gated calcium channels, while the second peptide blocks the inactivation of voltage-gated sodium channels. The first peptide is from <italic>Conus geographus</italic> (G) and the second is from <italic>Conus textile</italic> (Tx). The Roman numeral VI indicates that they have the same arrangement of cysteines, framework VI (C-C-CC-C-C) and the Arabic numeral A in each indicates that these peptides were the first conotoxins of this framework discovered from each species. Ultimately it is desirable that all peptides be characterized to the point where they can be named to reveal their mechanism of action.</p>
<p>Thus, for the <italic>Purpuraturris</italic> venom peptides, we would adopt a similar nomenclature except that to be able to encompass all conoidean venoms, non-cone snail venom peptides will have an additional letter, but otherwise the rules for nomenclature will be the same. Thus, the first identified Clade II peptide from <italic>Purpuraturris nadaensis</italic> (see manuscript, <xref ref-type="fig" rid="F5">Figure 5</xref>), if targeted to voltage-gated calcium channels would be ultimately designated as &#x3c9;-Turripeptide PndIXA, while the first peptide from <italic>Purpuraturris cristata</italic> would be &#x3c9;-Turripeptide PcsIXA. If these were targeted instead to potassium channels, the nomenclature would be &#x3ba;-Turripeptide TndIXA for a peptide from <italic>Turris normandavidsoni</italic>. The only difference from conopeptide nomenclature is the addition of a preceding letter to denote which genus within the family the peptide is derived from, followed by two lower case letters to denote the species. Thus, the calcium-targeted peptide from <italic>Turris hidalgoi</italic> would be &#x3c9;-Turripeptide ThdIXA, indicating that this is a peptide from a specific <italic>Turris</italic> species that is targeted to voltage-gated calcium channels and has cysteine framework IX (C-C-C-C-C-C). The advantage of this nomenclature is that it can be readily used for other conoidean families. Thus, the first peptide targeted to calcium channels from the family Drilliidae, for example from the species <italic>Clavus canalicularis</italic>, if it were also were a framework IX peptide, would be called &#x3c9;-Drillipeptide CcnIXA.</p>
<p>Following the conventional nomenclature established for cone snail venoms (<xref ref-type="bibr" rid="B12">Kaas et al., 2010</xref>), we suggest that before the mechanism of the peptide has been elucidated, the three-letter code, followed by an Arabic rather than Roman numeral to indicate the cysteine framework, followed by the clone number be used to identify all peptides with mechanisms that have not been determined (e.g., Tcs9.1, Thd9.8). Lower case roman numerals (ii, iii, iv, etc.) can be added following the clone number to denote minor sequence variation in an otherwise homologous peptide precursor from the same species, such as that arising from allelic variation (e.g., Pcr9.4ii vs Pcr9.4, Tsp9.2ii vs Tsp9.2). The distinction between a clone sequence and an actual biochemically-synthesized peptide could be made by capitalizing the former and using three small letters for the latter. Thus, once the peptide is available biochemically, the clone Thd9.1 is referred to as thd9.1.</p>
</sec>
</app>
</app-group>
</back>
</article>