<?xml version="1.0" encoding="UTF-8"?>
<!DOCTYPE article PUBLIC "-//NLM//DTD JATS (Z39.96) Journal Publishing DTD v1.3 20210610//EN" "JATS-journalpublishing1-3-mathml3.dtd">
<article xmlns:mml="http://www.w3.org/1998/Math/MathML" xmlns:xlink="http://www.w3.org/1999/xlink" xmlns:ali="http://www.niso.org/schemas/ali/1.0/" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" article-type="research-article" dtd-version="1.3" xml:lang="EN">
<front>
<journal-meta>
<journal-id journal-id-type="publisher-id">Front. Immunol.</journal-id>
<journal-title-group>
<journal-title>Frontiers in Immunology</journal-title>
<abbrev-journal-title abbrev-type="pubmed">Front. Immunol.</abbrev-journal-title>
</journal-title-group>
<issn pub-type="epub">1664-3224</issn>
<publisher>
<publisher-name>Frontiers Media S.A.</publisher-name>
</publisher>
</journal-meta>
<article-meta>
<article-id pub-id-type="doi">10.3389/fimmu.2025.1636591</article-id>
<article-version article-version-type="Version of Record" vocab="NISO-RP-8-2008"/>
<article-categories>
<subj-group subj-group-type="heading">
<subject>Original Research</subject>
</subj-group>
</article-categories>
<title-group>
<article-title>Immunization with the M12-N, M12-C, and M12-N+C fusion peptides derived from the M12 protein elicited varying levels of protective immune responses against multiple serotypes of group A <italic>Streptococcus</italic></article-title>
</title-group>
<contrib-group>
<contrib contrib-type="author" corresp="yes">
<name><surname>Zhang</surname><given-names>Xiaolan</given-names></name>
<xref ref-type="aff" rid="aff1"><sup>1</sup></xref>
<xref ref-type="corresp" rid="c001"><sup>*</sup></xref>
<uri xlink:href="https://loop.frontiersin.org/people/774295/overview"/>
<role vocab="credit" vocab-identifier="https://credit.niso.org/" vocab-term="supervision" vocab-term-identifier="https://credit.niso.org/contributor-roles/supervision/">Supervision</role>
<role vocab="credit" vocab-identifier="https://credit.niso.org/" vocab-term="conceptualization" vocab-term-identifier="https://credit.niso.org/contributor-roles/conceptualization/">Conceptualization</role>
<role vocab="credit" vocab-identifier="https://credit.niso.org/" vocab-term="methodology" vocab-term-identifier="https://credit.niso.org/contributor-roles/methodology/">Methodology</role>
<role vocab="credit" vocab-identifier="https://credit.niso.org/" vocab-term="Funding acquisition" vocab-term-identifier="https://credit.niso.org/contributor-roles/funding-acquisition/">Funding acquisition</role>
<role vocab="credit" vocab-identifier="https://credit.niso.org/" vocab-term="Writing &#x2013; original draft" vocab-term-identifier="https://credit.niso.org/contributor-roles/writing-original-draft/">Writing &#x2013; original draft</role>
<role vocab="credit" vocab-identifier="https://credit.niso.org/" vocab-term="Formal analysis" vocab-term-identifier="https://credit.niso.org/contributor-roles/formal-analysis/">Formal analysis</role>
</contrib>
<contrib contrib-type="author">
<name><surname>Ma</surname><given-names>Yue</given-names></name>
<xref ref-type="aff" rid="aff1"><sup>1</sup></xref>
<role vocab="credit" vocab-identifier="https://credit.niso.org/" vocab-term="investigation" vocab-term-identifier="https://credit.niso.org/contributor-roles/investigation/">Investigation</role>
<role vocab="credit" vocab-identifier="https://credit.niso.org/" vocab-term="Data curation" vocab-term-identifier="https://credit.niso.org/contributor-roles/data-curation/">Data curation</role>
<role vocab="credit" vocab-identifier="https://credit.niso.org/" vocab-term="software" vocab-term-identifier="https://credit.niso.org/contributor-roles/software/">Software</role>
<role vocab="credit" vocab-identifier="https://credit.niso.org/" vocab-term="Writing &#x2013; original draft" vocab-term-identifier="https://credit.niso.org/contributor-roles/writing-original-draft/">Writing &#x2013; original draft</role>
</contrib>
<contrib contrib-type="author">
<name><surname>Na</surname><given-names>Rige</given-names></name>
<xref ref-type="aff" rid="aff1"><sup>1</sup></xref>
<role vocab="credit" vocab-identifier="https://credit.niso.org/" vocab-term="resources" vocab-term-identifier="https://credit.niso.org/contributor-roles/resources/">Resources</role>
<role vocab="credit" vocab-identifier="https://credit.niso.org/" vocab-term="Writing &#x2013; original draft" vocab-term-identifier="https://credit.niso.org/contributor-roles/writing-original-draft/">Writing &#x2013; original draft</role>
<role vocab="credit" vocab-identifier="https://credit.niso.org/" vocab-term="investigation" vocab-term-identifier="https://credit.niso.org/contributor-roles/investigation/">Investigation</role>
</contrib>
<contrib contrib-type="author">
<name><surname>Hou</surname><given-names>Wenli</given-names></name>
<xref ref-type="aff" rid="aff2"><sup>2</sup></xref>
<uri xlink:href="https://loop.frontiersin.org/people/3195784/overview"/>
<role vocab="credit" vocab-identifier="https://credit.niso.org/" vocab-term="validation" vocab-term-identifier="https://credit.niso.org/contributor-roles/validation/">Validation</role>
<role vocab="credit" vocab-identifier="https://credit.niso.org/" vocab-term="Writing &#x2013; review &amp; editing" vocab-term-identifier="https://credit.niso.org/contributor-roles/writing-review-editing/">Writing &#x2013; review &amp; editing</role>
<role vocab="credit" vocab-identifier="https://credit.niso.org/" vocab-term="visualization" vocab-term-identifier="https://credit.niso.org/contributor-roles/visualization/">Visualization</role>
</contrib>
<contrib contrib-type="author">
<name><surname>Hanski</surname><given-names>Emanuel</given-names></name>
<xref ref-type="aff" rid="aff3"><sup>3</sup></xref>
<uri xlink:href="https://loop.frontiersin.org/people/164189/overview"/>
<role vocab="credit" vocab-identifier="https://credit.niso.org/" vocab-term="Writing &#x2013; review &amp; editing" vocab-term-identifier="https://credit.niso.org/contributor-roles/writing-review-editing/">Writing &#x2013; review &amp; editing</role>
<role vocab="credit" vocab-identifier="https://credit.niso.org/" vocab-term="conceptualization" vocab-term-identifier="https://credit.niso.org/contributor-roles/conceptualization/">Conceptualization</role>
<role vocab="credit" vocab-identifier="https://credit.niso.org/" vocab-term="Funding acquisition" vocab-term-identifier="https://credit.niso.org/contributor-roles/funding-acquisition/">Funding acquisition</role>
</contrib>
<contrib contrib-type="author" corresp="yes">
<name><surname>Zhou</surname><given-names>Qin</given-names></name>
<xref ref-type="aff" rid="aff1"><sup>1</sup></xref>
<xref ref-type="corresp" rid="c001"><sup>*</sup></xref>
<uri xlink:href="https://loop.frontiersin.org/people/1718524/overview"/>
<role vocab="credit" vocab-identifier="https://credit.niso.org/" vocab-term="supervision" vocab-term-identifier="https://credit.niso.org/contributor-roles/supervision/">Supervision</role>
<role vocab="credit" vocab-identifier="https://credit.niso.org/" vocab-term="conceptualization" vocab-term-identifier="https://credit.niso.org/contributor-roles/conceptualization/">Conceptualization</role>
<role vocab="credit" vocab-identifier="https://credit.niso.org/" vocab-term="Writing &#x2013; review &amp; editing" vocab-term-identifier="https://credit.niso.org/contributor-roles/writing-review-editing/">Writing &#x2013; review &amp; editing</role>
<role vocab="credit" vocab-identifier="https://credit.niso.org/" vocab-term="Funding acquisition" vocab-term-identifier="https://credit.niso.org/contributor-roles/funding-acquisition/">Funding acquisition</role>
</contrib>
</contrib-group>
<aff id="aff1"><label>1</label><institution>School of Basic Medical Sciences, Harbin Medical University</institution>, <city>Harbin</city>,&#xa0;<country country="cn">China</country></aff>
<aff id="aff2"><label>2</label><institution>Chengdu Ruiyi Biotechnology Co., Ltd.</institution>, <city>Chengdu</city>,&#xa0;<country country="cn">China</country></aff>
<aff id="aff3"><label>3</label><institution>Department of Microbiology and Molecular Genetics, The Institute for Medical Research, Israel-Canada (IMRIC), Faculty of Medicine, The Hebrew University of Jerusalem</institution>, <city>Jerusalem</city>,&#xa0;<country country="il">Israel</country></aff>
<author-notes>
<corresp id="c001"><label>*</label>Correspondence: Xiaolan Zhang, <email xlink:href="mailto:zhangxl@ems.hrbmu.edu.cn">zhangxl@ems.hrbmu.edu.cn</email>; Qin Zhou, <email xlink:href="mailto:zhouqin@hrbmu.edu.cn">zhouqin@hrbmu.edu.cn</email></corresp>
</author-notes>
<pub-date publication-format="electronic" date-type="pub" iso-8601-date="2025-11-21">
<day>21</day>
<month>11</month>
<year>2025</year>
</pub-date>
<pub-date publication-format="electronic" date-type="collection">
<year>2025</year>
</pub-date>
<volume>16</volume>
<elocation-id>1636591</elocation-id>
<history>
<date date-type="received">
<day>12</day>
<month>06</month>
<year>2025</year>
</date>
<date date-type="accepted">
<day>30</day>
<month>10</month>
<year>2025</year>
</date>
</history>
<permissions>
<copyright-statement>Copyright &#xa9; 2025 Zhang, Ma, Na, Hou, Hanski and Zhou.</copyright-statement>
<copyright-year>2025</copyright-year>
<copyright-holder>Zhang, Ma, Na, Hou, Hanski and Zhou</copyright-holder>
<license>
<ali:license_ref start_date="2025-11-21">https://creativecommons.org/licenses/by/4.0/</ali:license_ref>
<license-p>This is an open-access article distributed under the terms of the <ext-link ext-link-type="uri" xlink:href="https://creativecommons.org/licenses/by/4.0/">Creative Commons Attribution License (CC BY)</ext-link>. The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.</license-p>
</license>
</permissions>
<abstract>
<p>The M protein located on the surface of group A <italic>Streptococcus</italic> has been extensively researched as a promising vaccine candidate. However, issues such as potential cross-reactivity with human tissues and the impact of selection of M peptide sequences have raised concerns regarding the safety and efficacy of the M protein vaccine. In this study, we utilized a KSI (ketosteroid isomerase, 15.78 kDa) tag and conducted a comparative analysis of the N-terminal (M12-N, 28.14 kDa), C-terminal (M12-C, 30.24 kDa), and fusion form (M12-N+C, 29.19 kDa) derived from the M12 protein found in MGAS9429. Three vaccine candidates formulated with aluminum hydroxide adjuvant significantly increased specific antibody titers in serum following booster immunization. Furthermore, immunization with these vaccines improved the survival rates in mice challenged subcutaneously with MGAS9429 compared to control mice. The immune responses induced by our vaccine formulation were characterized by Th1 type responses marked by IFN-&#x3b3; secretion rather than the Th2 type responses and a notable increase in effector memory T cells. Significantly, the vaccine candidate M12-C exhibited several advantages including shortened vaccination times, enhanced antibody levels, improved survival rates against non-vaccine serotype MGAS5005 challenge. Moreover, the M12-C antiserum demonstrated significant opsonization and killing effects on the non-vaccine strains of M1, M3, M6 and M18. This work identifies a promising fusion sequence of vaccine candidate when developing GAS vaccines based on M peptides to enhance immune responses and protective efficacy.</p>
</abstract>
<kwd-group>
<kwd>M peptide</kwd>
<kwd>ketosteroid isomerase</kwd>
<kwd>vaccine</kwd>
<kwd>protective efficacy</kwd>
<kwd>group A streptococcus</kwd>
<kwd>infection</kwd>
</kwd-group>
<funding-group>
<award-group id="gs1">
<funding-source id="sp1">
<institution-wrap>
<institution>Ministry of Science and Technology of the People's Republic of China</institution>
<institution-id institution-id-type="doi" vocab="open-funder-registry" vocab-identifier="10.13039/open_funder_registry">10.13039/501100002855</institution-id>
</institution-wrap>
</funding-source>
<award-id rid="sp1">2023YFE0113500</award-id>
</award-group>
<award-group id="gs2">
<funding-source id="sp2">
<institution-wrap>
<institution>National Natural Science Foundation of China</institution>
<institution-id institution-id-type="doi" vocab="open-funder-registry" vocab-identifier="10.13039/open_funder_registry">10.13039/501100001809</institution-id>
</institution-wrap>
</funding-source>
<award-id rid="sp2">82202525</award-id>
</award-group>
<award-group id="gs3">
<funding-source id="sp3">
<institution-wrap>
<institution>Ministry of Innovation, Science and Technology</institution>
<institution-id institution-id-type="doi" vocab="open-funder-registry" vocab-identifier="10.13039/open_funder_registry">10.13039/501100001738</institution-id>
</institution-wrap>
</funding-source>
<award-id rid="sp3">0005663</award-id>
</award-group>
<funding-statement>The author(s) declare financial support was received for the research and/or publication of this article. This work was supported by the grants from National Key R&amp;D Program from Ministry of Science and Technology of China (2023YFE0113500), Chinese National Natural Science Foundation (82202525), the Israeli Ministry of Innovation, Science and Technology (0005663) and GenScript Life Sciences Research Funding Program.</funding-statement>
</funding-group>
<counts>
<fig-count count="5"/>
<table-count count="0"/>
<equation-count count="0"/>
<ref-count count="30"/>
<page-count count="10"/>
<word-count count="5057"/>
</counts>
<custom-meta-group>
<custom-meta>
<meta-name>section-at-acceptance</meta-name>
<meta-value>Vaccines and Molecular Therapeutics</meta-value>
</custom-meta>
</custom-meta-group>
</article-meta>
</front>
<body>
<sec id="s1" sec-type="intro">
<label>1</label>
<title>Introduction</title>
<p><italic>Streptococcus pyogenes</italic>, also known as group A <italic>Streptococcus</italic> (GAS), is responsible for causing acute and chronic infectious diseases of significant global concern. It is estimated that there are 639,000 deaths annually due to rheumatic heart disease (RHD) and invasive GAS infections (<xref ref-type="bibr" rid="B1">1</xref>&#x2013;<xref ref-type="bibr" rid="B3">3</xref>). Despite the substantial impact of these diseases, there is currently no commercially available vaccine for GAS (<xref ref-type="bibr" rid="B4">4</xref>&#x2013;<xref ref-type="bibr" rid="B6">6</xref>). Due to the fact that the M protein is capable of inducing the generation of opsonophagocyte antibodies, M proteins including M1, 3, 6 and 14 had been extensively researched as vaccine candidates (<xref ref-type="bibr" rid="B7">7</xref>&#x2013;<xref ref-type="bibr" rid="B10">10</xref>). However, the full-length M protein vaccine possesses a potential risk of RHD in humans (<xref ref-type="bibr" rid="B10">10</xref>). M peptide vaccines lacking cross-reactive fragments with human antigens are more promising compared to the M protein vaccines (<xref ref-type="bibr" rid="B11">11</xref>&#x2013;<xref ref-type="bibr" rid="B17">17</xref>). The M peptide vaccine StreptInCor, composed of 55 amino acid residues from the C-terminal region of the M5 protein, demonstrates immunogenicity and the ability to opsonize M1, M5, M12, M22 and M87 GAS strains (<xref ref-type="bibr" rid="B11">11</xref>, <xref ref-type="bibr" rid="B12">12</xref>). Another C-terminal vaccine known as J8, representing the minimal B cell epitope within p145 and conjugated to diphtheria toxoid (DT) or CRM197, has been shown to provide protection against GAS infection (<xref ref-type="bibr" rid="B13">13</xref>, <xref ref-type="bibr" rid="B14">14</xref>). However, promising developments in the form of 26-valent and 30-valent N terminal vaccines are undergoing various stages of clinical trials (<xref ref-type="bibr" rid="B15">15</xref>&#x2013;<xref ref-type="bibr" rid="B17">17</xref>). Approximately 59.28% of the detected strains in China belong to the M12 serotype, while 34.86% are classified as belonging to the M1 serotype (<xref ref-type="bibr" rid="B18">18</xref>). Therefore, our focus is on the predominant M12 serotype, and we aim to develop a monovalent or bivalent vaccine with a low molecular weight and minimal side effects. A previous study has revealed that the recombinant M1 protein provides 100% protection against the same serotype and possesses the ability to induce the production of bactericidal antibodies (<xref ref-type="bibr" rid="B19">19</xref>). Therefore, it is a viable option to select M peptides from M12 protein that do not have cross-reactivity with human tissue. However, the selection of M peptides may impact the effectiveness of vaccines. In this study, the hypervariable N-terminal sequence of the M12 protein was selected based on the first 50 amino acid residues of the mature protein following the removal of the signal peptide, while the conservative C-terminal sequence was selected based on a segment of 63 amino acid residues encompassing both the T-cell epitope and the B-cell epitope. The amino acid sequences were compared against human homologous protein sequences using blastp (<ext-link ext-link-type="uri" xlink:href="https://blast.ncbi.nlm.nih.gov/Blast.cgi">https://blast.ncbi.nlm.nih.gov/Blast.cgi</ext-link>) respectively, and no homology was found. It has been tentatively concluded that these sequences may be exclusive to bacteria. Furthermore, KSI is a naturally occurring small protein that is found in prokaryotes. Its amino acid sequence exhibits minimal homology with mammalian proteins. In addition to its inherent immunogenicity, KSI can function as a carrier molecule, effectively amplifying the immune response to weak antigens. We selected it as the carrier for the M12 peptide to facilitate the proper folding of the antigenic peptide and enhance its expression level. Furthermore, GAS frequently leads to impetigo, therefore a mouse subcutaneous infection model was employed to assess the protective effect against infection in this study (<xref ref-type="bibr" rid="B20">20</xref>, <xref ref-type="bibr" rid="B21">21</xref>). This study aims to evaluate the efficacy of N-terminal and C-terminal vaccines, as well as M12-N+C. The optimal sequence we have identified can also be combined with non-M protein sequences to construct novel GAS vaccines, thereby further improving the protective efficacy.</p>
</sec>
<sec id="s2" sec-type="materials|methods">
<label>2</label>
<title>Materials and methods</title>
<sec id="s2_1">
<label>2.1</label>
<title>Bacterial strains and culture condition</title>
<p>GAS was cultured in Todd-Hewitt broth (BD) supplemented with 0.2% yeast extract (THY) at 37 &#xb0;C with 5% CO<sub>2</sub>. The bacteria were grown to the logarithmic phase in THY (OD<sub>600</sub>&#xa0;=&#xa0;0.6 to 0.8), then pelleted, washed and resuspended in phosphate buffered saline (PBS) at the desired concentration. The strain information utilized in this study is presented as follows: MGAS5005 (M1, ATCC: BAA-947), SF370 (M1, ATCC: 700294), MGAS10270 (M2, ATCC: BAA-1063), MGAS315 (M3, ATCC: BAA-595), MGAS10750 (M4, ATCC: BAA-1066), 19615 (M5, ATCC: 19615), MGAS10394 (M6, ATCC: BAA-946), MGAS9429 (M12, ATCC: BAA-1315), MGAS8232 (M18, ATCC: BAA-572), MGAS6180 (M28, ATCC: BAA-1064), NZ131 (M49, ATCC: BAA-1633), B514 (M50, ATCC: 12382), Alab49 (M53, ATCC: BAA-1323).</p>
</sec>
<sec id="s2_2">
<label>2.2</label>
<title>Gene synthesis, protein expression and purification</title>
<p>The full-length sequence of M12 protein (GenBank: ABF32911.1, 575 aa) was analyzed. The adjusted KSI sequence from <italic>Comamonas</italic> testosteroni (MGSSHHHHHHSSGLVPRGSHMHTPEHITAVVQRFVAALNAGDLDGIVALFADDATVEDPVGSEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFTVSFEYQGRKTVVAPIDHFRFNGAGKVVSIRALFGEKNIHACQGS) and the sequences of M12-N (amino acids 42 to 91), M12-C (amino acids 376 to 438) and M12-N+C were synthesized together and cloned into the pET-28b (+) vectors (between NdeI and EcoRI) to produce the recombinant plasmids respectively. Subsequently, the recombinant plasmids were transformed into <italic>E.coli</italic> T7 Express in order to induce the expression of proteins upon induction with 1 mM IPTG at 37 &#xb0;C, with shaking 200rpm for 4 hours. The bacterial precipitates were obtained through centrifugation, subsequently treated with sonication, and filtered. The recombinant proteins in supernatant were then purified using Ni resin affinity chromatography (HISTRAP HP, Cytiva). Protein was detected using a 12% SDS-PAGE and the concentration was determined with a BCA protein assay kit.</p>
</sec>
<sec id="s2_3">
<label>2.3</label>
<title>Vaccine formulation</title>
<p>The 50 &#x3bc;g of purified recombinant protein was diluted with PBS to a total volume of 50 &#x3bc;l. Subsequently, the protein solution was mixed with an equal-volume (50 &#x3bc;l) aluminum hydroxide adjuvant (ThermoFisher), generating three vaccine candidates: M12-N, M12-C, and M12-N+C respectively. The control mice were administered either 50 &#x3bc;g of recombinant KSI protein plus a 50 &#x3bc;l adjuvant (KSI-Alum) or a mixture of 50 &#x3bc;l PBS and an equal-volume adjuvant (PBS-Alum).</p>
</sec>
<sec id="s2_4">
<label>2.4</label>
<title>Mouse vaccination and challenge experiments</title>
<p>Female BALB/c mice (6 to 8 weeks old) were purchased from Liaoning Changsheng Biotechnology Co., Ltd. The mice received intramuscular immunization three times with 100 &#x3bc;l of protein plus adjuvant or PBS plus adjuvant on days 0, 14 and 28. The number of each group was as follows: M12-N (n=37), M12-C (n=37), M12-N+C (n=37), KSI-Alum (n=37), PBS-Alum (n=58). Body weight was measured every two weeks, and the sera were collected at specific time points. On day 42, the mice were challenged by subcutaneous injection with GAS at a dose of 2.0&#xd7;10<sup>8</sup> CFU per mouse. Subsequently, the survival rate of mice was monitored for a period of 15 days, and both skin lesion as well as cytokine levels were assessed to evaluate the efficacy of the vaccine. On day 56, mice were sacrificed by the cervical dislocation after being anesthetized with tribromoethanol (4&#x2009;mg/10&#xa0;g body weight) by intraperitoneal injection. All animal procedures were reviewed and approved by the Institutional Research Board of Harbin Medical University (Assurance Number: HMUIRB2024011).</p>
</sec>
<sec id="s2_5">
<label>2.5</label>
<title>Serum specific antibody titers</title>
<p>Blood samples were collected on days 0, 14, 28, 42 and 56 via tail bleeding and subsequently stored at -80&#xb0;C after serum separation. Enzyme-linked immunosorbent assay (ELISA) was performed in a 96-well Costar plate coated with 100 &#x3bc;l recombinant protein M12-N, M12-C or M12-N+C (2 &#x3bc;g/ml in 50 mM sodium carbonate solution, pH 9.6) per well overnight at 4&#xb0;C. Subsequently, the wells were blocked with 3% BSA at 37&#xb0;C for 2 hours followed by washing the wells thrice with PBST containing 0.05% Tween to remove any excess protein. The gradient diluted antisera were then added into the wells for a duration of one hour. Then HRP-labeled goat anti-mouse IgG was added to each well for another hour prior to washing thrice and the TMB substrate solvent was added and incubated for ten minutes before adding 2M HCl to detect the absorbance values at 450nm. The final titer was determined as the A450nm value of the highest dilution of antisera, which exceeded three times the A450nm value of the 1:1000 dilution of pre-immunization sera.</p>
</sec>
<sec id="s2_6">
<label>2.6</label>
<title>Flow cytometric analysis</title>
<p>On days 19 and 33, mice were sacrificed by the cervical dislocation after being anesthetized with tribromoethanol (4mg/10g body weight) by intraperitoneal injection. Spleens were harvested from these immunized mice. A total of 10<sup>6</sup> splenocytes were stimulated with leukocyte activation cocktail with BD GolgiPlug (BD Pharmingen, product No. 550583) for 5 hours at 37&#xb0;C with 5% CO<sub>2</sub> to block cytokine secretion. After stimulation, splenocytes were washed twice with PBS and surface-stained on ice for 20 minutes using fluorescently-labeled antibodies to CD3 (FITC), CD4 (PE), CD44 (PE-CY7), CD62L (Percp-cy5.5). Subsequently, the splenocytes were fixed and permeabilized with fixation/permeablization kit (BD Pharmingen, product No. 554714) at 4&#xb0;C for 20 minutes, followed by washing. The intracellular staining was performed in the dark for 30 minutes using IL-4 (PE-CF594) and IFN-&#x3b3; (APC) or an appropriate isotype control (All the above antibodies were from BioLegend). The dead cells were then stained with zombie NIR&#x2122; fixable viability kit (BioLegend), and samples were analyzed using a FACSVerse flow cytometer (BD Biosciences). Data were analyzed with the FlowJo software.</p>
</sec>
<sec id="s2_7">
<label>2.7</label>
<title>Opsonophagocytic killing assay</title>
<p>Briefly, 10 &#x3bc;l of GAS, washed and diluted to 2,000 CFU per well in opsonization buffer (composed of 10% [vol/vol] fetal bovine serum and 0.1% [wt/vol] gelatin in Hanks&#x2019; balanced salt solution containing Ca/Mg), was incubated at room temperature for 10 minutes with shaking at 700 rpm on a mini-orbital shaker alongside 20 &#x3bc;l of antisera that had been serially diluted in the opsonization buffer within a round-bottomed 96-well plate. Following this, 100 &#x3bc;l (&#x2248;1&#xd7;10<sup>6</sup>) of differentiated human promyelocytic leukemia cells (HL-60) were added to each dilution of serum. This mixture was then incubated for one hour at 37&#xb0;C with an atmosphere enriched with 5% CO<sub>2</sub> while maintaining shaking at a speed of 700 rpm. Prior to the assay, HL-60 cells were cultured in IMDM medium supplemented with 15% fetal bovine serum (Gibco) until they reached the logarithmic growth phase (<xref ref-type="bibr" rid="B22">22</xref>). HL-60 cells underwent differentiation by incubation in a medium containing 0.8% dimethylformamide (DMF) at a controlled temperature of 37&#xb0;C with an atmosphere comprising 5% CO<sub>2</sub> for five days (see <xref ref-type="supplementary-material" rid="SM1"><bold>Supplementary Figure S3</bold></xref>). Subsequently, the plates were placed on ice, and ten microliters from each well were spotted onto THY agar plates. These plates were incubated overnight at 37&#xb0;C enriched with 5% CO<sub>2</sub> and the colonies were counted the next day. The following acceptance criteria was adopted: non-specific killing of less than 35% and the maximum killing of at least 70% for test serum (<xref ref-type="bibr" rid="B23">23</xref>). The percent of killing was calculated by using the following formula: {[(CFU after 1&#xa0;h of growth with preimmune serum) - (CFU after 1&#xa0;h of growth with threefold diluted immune serum)] &#xf7; CFU after 1&#xa0;h of growth with preimmune serum} &#xd7; 100.</p>
</sec>
<sec id="s2_8">
<label>2.8</label>
<title>Cytokine quantification</title>
<p>The splenocyte samples collected from immunized mice on days 19 and 33, as well as the splenic homogenates were utilized for cytokine measurement. The samples or homogenate underwent centrifugation to obtain supernatant, from which the concentrations of IFN-&#x3b3; and IL-4 were quantified using ELISA kits in accordance with the guidelines provided by the manufacturer (product No. E-EL-M0048 and E-EL-M0043, Elabscience Biotechnology Co., Ltd.).</p>
</sec>
<sec id="s2_9">
<label>2.9</label>
<title>Statistical analysis</title>
<p>The data were analyzed using Student&#x2019;s <italic>t</italic>-test or paired <italic>t</italic>-test. The serum titers were evaluated by two-way ANOVA with Tukey&#x2019;s multiple comparisons test. The log-rank test was utilized to analyze the survival rates of the mice. All figures were plotted using GraphPad Prism version 8.&#xa0;P values less than 0.05 were considered as statistically significant.</p>
</sec>
</sec>
<sec id="s3" sec-type="results">
<label>3</label>
<title>Results</title>
<sec id="s3_1">
<label>3.1</label>
<title>The antigen design of vaccine candidates</title>
<p>The complete sequence of the M12 protein (GenBank: ABF32911.1) was aligned with multiple M proteins from serotypes <italic>emm</italic> 1, 3, 4, 5, 6, 18, and 49 to 59. Both the type-specific N-terminal sequence (amino acids 42 to 91) and relatively conserved C-terminal sequence (amino acids 376 to 438) of the M12 protein were selected as antigen sequences. Subsequently, a KSI tag was added to the front of each sequence and a GS linker was inserted in the middle of the antigenic peptide. This resulted in three combinations as depicted in <xref ref-type="fig" rid="f1"><bold>Figure&#xa0;1A</bold></xref> and they were named M12-N, M12-C, and M12-N+C respectively. The recombinant proteins were verified by electrophoresis (<xref ref-type="fig" rid="f1"><bold>Figure&#xa0;1B</bold></xref>).</p>
<fig id="f1" position="float">
<label>Figure&#xa0;1</label>
<caption>
<p>The antigen constructs and proteins detected by SDS-PAGE. <bold>(A)</bold> The antigen constructs of the vaccine candidates involved repeating and connecting the M-peptide sequence with a GS linker. <bold>(B)</bold> The recombinant plasmids were transformed into <italic>E.coli</italic> T7 Express and recombinant proteins were expressed and detected.</p>
</caption>
<graphic mimetype="image" mime-subtype="tiff" xlink:href="fimmu-16-1636591-g001.tif">
<alt-text content-type="machine-generated">Diagram and gel image depict protein constructs and their expression profiles. Panel A illustrates three constructs: M12-N, M12-C, and M12-N+C, detailing KSI tags, linkers, and terminal regions with specific amino acid sequences. Panel B shows SDS-PAGE results for M12-N, M12-C, and M12-N+C, displaying protein bands with molecular weight markers ranging from ten to two hundred fifty kilodaltons.</alt-text>
</graphic></fig>
</sec>
<sec id="s3_2">
<label>3.2</label>
<title>Mice exhibited weight gain after immunization with three vaccine candidates that induced high levels of specific antibodies in serum</title>
<p>Mice were vaccinated or treated according to the immune procedure shown in <xref ref-type="fig" rid="f2"><bold>Figure&#xa0;2A</bold></xref>. ELISA was utilized to detect the specific antibody levels directed against antigens. The vaccine candidate M12-C significantly elevated the antigen-specific serum antibodies after the first immunization, yielding an endpoint titer of 1:128000 after the second immunization (<xref ref-type="fig" rid="f2"><bold>Figures&#xa0;2B, C</bold></xref>). In contrast, both M12-N and M12-N+C induced a titer of 1:32000 after the second immunization (<xref ref-type="fig" rid="f2"><bold>Figure&#xa0;2C</bold></xref>). Subsequent to the third immunization, M12-N exhibited an endpoint titer of 1:128000, while M12-N+C had a titer of 1:64000 (<xref ref-type="fig" rid="f2"><bold>Figure&#xa0;2D</bold></xref>). In comparison with KSI-Alum and PBS-Alum, all three vaccine candidates elicited higher levels of specific antibodies (<xref ref-type="fig" rid="f2"><bold>Figure&#xa0;2E</bold></xref>). Meanwhile, the average weight of the mice gradually increased, and there were no fatalities during the immunization process (<xref ref-type="fig" rid="f2"><bold>Figure&#xa0;2F</bold></xref>). These findings provide further evidence of the safety of the vaccine formulations. It is important to note that M12-C offers advantages in terms of reducing the number of required vaccinations and enhancing antibody levels.</p>
<fig id="f2" position="float">
<label>Figure&#xa0;2</label>
<caption>
<p>The serum antibody levels and body weights of immunized mice. <bold>(A)</bold> Schematic diagram illustrating the immunization process, sample collection, and challenge schedule. <bold>(B-D)</bold> Serum antibody levels determined by ELISA two weeks after each immunization. Data are represented as the mean &#xb1; SEM, n=6 for each group. <bold>(E)</bold> Statistical graph depicting the serum antibody levels. Data are represented as the mean &#xb1; SEM, n=6 for each group. <bold>(F)</bold> Changes in body weight throughout the vaccination process. Data are represented as the mean &#xb1; SD, M12-N (n=37), M12-C (n=37), M12-N+C (n=37), KSI-Alum (n=8), PBS-Alum (n=58). *<italic>P</italic>&#xa0;&lt;&#xa0;0.05, **<italic>P</italic>&#xa0;&lt;&#xa0;0.01, ***<italic>P</italic>&#xa0;&lt;&#xa0;0.001.</p>
</caption>
<graphic mimetype="image" mime-subtype="tiff" xlink:href="fimmu-16-1636591-g002.tif">
<alt-text content-type="machine-generated">Diagram illustrating a scientific experiment and results. Panel A shows a timeline of treatment steps in mice, including immunization, serum collection, spleen collection, and GAS challenge over 56 days. Panels B, C, and D present graphs of serum antibody titers at different stages, with data for M12-N, M12-C, M12-N+C, KSI-Alum, and PBS-Alum. Panel E displays bar graphs of \(A_{450}\) on days 14, 28, and 42, showing significant differences marked by asterisks. Panel F presents a box plot of body weight changes over time, with significant differences indicated.</alt-text>
</graphic></fig>
</sec>
<sec id="s3_3">
<label>3.3</label>
<title>Immunization with the three vaccine candidates protected mice against MGAS9429 infection</title>
<p>To assess the efficacy of vaccination in providing protection against GAS infection, mice were subcutaneously challenged with MGAS9429 or MGAS5005. As shown in <xref ref-type="fig" rid="f3"><bold>Figure&#xa0;3A</bold></xref>, at day 15 post-MGAS9429 challenge, it was observed that 75% of M12-C immunized mice survived, while only 11.76% of PBS-Alum immunized mice (Log-rank test: M12-C vs. PBS-Alum <italic>P</italic>&#xa0;=&#xa0;0.0005 and vs. KSI-Alum <italic>P</italic>&#xa0;=&#xa0;0.0469), 54.54% of M12-N immunized mice (vs. PBS-Alum <italic>P</italic>&#xa0;=&#xa0;0.0230 and vs. KSI-Alum <italic>P</italic>&#xa0;=&#xa0;0.3502) and 61.53% of M12-N+C immunized mice survived (vs. PBS-Alum <italic>P</italic>&#xa0;=&#xa0;0.0091 and vs. KSI-Alum <italic>P</italic>&#xa0;=&#xa0;0.2728) respectively. All mice immunized with PBS-Alum became moribund whereas a 33.3% survival rate was observed for KSI-Alum immunized mice (vs. PBS-Alum <italic>P</italic>&#xa0;=&#xa0;0.2122, not significant). The combined immunization with KSI tag and aluminum adjuvant resulted in an elevation of the corresponding antibody levels (<xref ref-type="fig" rid="f2"><bold>Figure&#xa0;2E</bold></xref>). This unexpected immune protective effect may be associated with the elevated antibody levels in mice induced by KSI immunization as a heterologous protein. Nevertheless, this effect might not be sufficient to confer protective immunity against infection in mice. Our experiments in rabbits also demonstrated that KSI immunization resulted in increased serum antibody levels (see <xref ref-type="supplementary-material" rid="SM1"><bold>Supplementary Table S1</bold></xref>). These results indicate that the protective effects against MGAS9429 challenge are partly attributed to KSI vaccination but mostly led by the three vaccine antigens. Furthermore, it was observed that immunization with M12-C provided more robust protection against the non-vaccine serotype MGAS5005, and even achieved a 87.5% survival rate (<xref ref-type="fig" rid="f3"><bold>Figure&#xa0;3B</bold></xref>). In contrast, both M12-N and M12-N+C failed to confer protection against MGAS5005. In addition, on the 7th day post infection, the number of bacterial colonies in skin inoculation site, spleen, and kidneys of the surviving mice was assessed. The results indicated that the vaccinated groups, particularly the M12-C group, exhibited a statistically significant reduction in colony counts compared to the control group (see <xref ref-type="supplementary-material" rid="SM1"><bold>Supplementary Figure S1</bold></xref>). Our studies suggest that M12-C is superior to its counterparts in providing protection against GAS infections.</p>
<fig id="f3" position="float">
<label>Figure&#xa0;3</label>
<caption>
<p>Efficacy evaluation against GAS challenge in mice. The efficacy of the immunization was evaluated against GAS challenge in mice, with the survival rates of immunized mice challenged by <bold>(A)</bold> MGAS9429, n=10 for each group and <bold>(B)</bold> MGAS5005, n=8 for each group being assessed. The mice received a subcutaneous inoculation via the dorsal surface with 2.0&#xd7;10<sup>8</sup> CFU and the survival rates were analyzed using the log-rank test. <bold>(C)</bold> Serum antibody titers of 1:2000 were compared before and after MGAS9429 challenge to assess immune response. ELISA plates were coated with respective antigens. Data are represented as the mean &#xb1; SD, n=6 for each group besides KSI-Alum (n=3). Statistical analysis was performed using a paired <italic>t</italic>-test. The levels of IFN-&#x3b3; <bold>(D)</bold> and IL-4 <bold>(E)</bold> in the splenic homogenates of mice infected with 2.0 &#xd7; 10<sup>8</sup> CFU MGAS9429 were measured. Data are represented as the mean &#xb1; SD, n=4 for each group. <bold>(F)</bold> Representative pictures of skin lesion of immunized mice post challenge. *<italic>P</italic>&#xa0;&lt;&#xa0;0.05, **<italic>P</italic>&#xa0;&lt;&#xa0;0.01, ***<italic>P</italic>&#xa0;&lt;&#xa0;0.001.</p>
</caption>
<graphic mimetype="image" mime-subtype="tiff" xlink:href="fimmu-16-1636591-g003.tif">
<alt-text content-type="machine-generated">Survival rate graphs, bar charts, and photos detail an experiment on infection impact. Graphs A and B show survival rates over 15 days for various treatments, with M12-N and M12-C showing higher survival. Bar charts C, D, and E measure A450, IFN-&#x3b3;, and IL-4 levels respectively, with significant differences across groups. Photos in panel F display infected mice wounds under different treatments, emphasized with a ruler for scale.</alt-text>
</graphic></fig>
<p>Moreover, mice immunized with M12-C maintained a higher level of antibodies compared to those immunized with M12-N or M12-N+C after the challenge (<xref ref-type="fig" rid="f3"><bold>Figure&#xa0;3C</bold></xref>). The antibody level in M12-C immunized mice did not decrease significantly and was able to sustain a high level after the MGAS9429 challenge. In contrast, the antibody levels in KSI-Alum immunized mice decreased notably, correlating with a relatively low survival rate among the mice. Fifteen days after challenge with MGAS9429, the splenic homogenate of mice immunized with M12-C exhibited a higher level of IFN-&#x3b3; and a lower level of IL-4 compared to control mice (<xref ref-type="fig" rid="f3"><bold>Figures&#xa0;3D, E</bold></xref>). The surviving M12-C immunized mice showed a robust Th1-type immunity following the MGAS9429 challenge. In addition, it can be seen from the skin lesion photos of mice that the inflammatory reaction of mice immunized with M12-C was mildest, while mice immunized with PBS-Alum was severest (<xref ref-type="fig" rid="f3"><bold>Figure&#xa0;3F</bold></xref>). The abscess was deeper and larger in the control mice. These findings indicate that immunization with M12-C may offer prolonged protection post infection.</p>
</sec>
<sec id="s3_4">
<label>3.4</label>
<title>The vaccine candidates primarily induced Th1-type immunity, and increased the proportion of effector memory T cell</title>
<p>To assess the cellular immunity induced by the vaccine candidates, splenocytes and splenic homogenates from immunized mice were harvested. The levels of IFN-&#x3b3; and IL-4, which represent Th1 and Th2 type immunity respectively, were measured. The proportion of CD4<sup>+</sup> IFN-&#x3b3; producing T cells significantly increased after the third immunization compared to those after the second immunization (<xref ref-type="fig" rid="f4"><bold>Figure&#xa0;4A</bold></xref>). This indicates that the vaccination can enhance the differentiation of CD4<sup>+</sup> T cells into Th1 effector cells and regulate the immune response by increasing IFN-&#x3b3; generation. However, the IL-4 levels remained low both prior to and following immunizations (see <xref ref-type="supplementary-material" rid="SM1"><bold>Supplementary Figure S2</bold></xref>). We proposed that the enhanced Th1 response observed was not a divergence from an effective pathway, but rather a crucial component of a multifaceted defense system that equipped macrophages and neutrophils as a rapid first line of bacterial clearance. IFN-&#x3b3; itself can further optimize the humoral response by promoting B-cell class-switching to potent opsonic IgG subclasses (<xref ref-type="bibr" rid="B24">24</xref>, <xref ref-type="bibr" rid="B25">25</xref>). In conclusion, this study observed Th1 responses, particularly increased IFN-&#x3b3; production, playing a significant role in protective immunity against GAS infection.</p>
<fig id="f4" position="float">
<label>Figure&#xa0;4</label>
<caption>
<p>Immunization elicited a higher frequency of CD4<sup>+</sup> IFN-&#x3b3; producing T cells and CD4<sup>+</sup> Tem cells predominate following the third immunization. <bold>(A)</bold> The percentage of IFN-&#x3b3; secreting cells, <bold>(B)</bold> Tem and <bold>(C)</bold> Tcm in CD3<sup>+</sup>CD4<sup>+</sup> T cells was determined. Data are represented as the mean &#xb1; SD, n=3 for each group, showing an increase with statistical significance indicated by *<italic>P</italic>&#xa0;&lt;&#xa0;0.05, **<italic>P</italic>&#xa0;&lt;&#xa0;0.01, ***<italic>P</italic>&#xa0;&lt;&#xa0;0.001.</p>
</caption>
<graphic mimetype="image" mime-subtype="tiff" xlink:href="fimmu-16-1636591-g004.tif">
<alt-text content-type="machine-generated">Bar charts labeled A, B, and C display percentages of IFN-gamma secreting cells, Tem, and Tcm in CD3+CD4+T cells over days 19 and 33. Different shapes represent groups M12-N, M12-C, M12-N+C, and KSI-Alum. Statistical significance is indicated by asterisks, with varying levels across the bars.</alt-text>
</graphic></fig>
<p>Moreover, this study investigated the alterations in memory T cells of immunized mice. These findings were presented in <xref ref-type="supplementary-material" rid="SM1"><bold>Supplementary Figure S2</bold></xref>, which illustrated a significant increase in the proportion of effector memory T cells (Tem) from just over 30% to more than 60% after the third immunization. This demonstrates that the third immunization notably heightened the proportion of Tem and central memory T cells, Tcm (<xref ref-type="fig" rid="f4"><bold>Figures&#xa0;4B, C</bold></xref>). It is likely that the vaccine candidates prolong the duration of immune protection by enhancing the quantity of memory T cells.</p>
</sec>
<sec id="s3_5">
<label>3.5</label>
<title>The antiserum showed varying degrees of opsonization-mediated phagocytic killing effects against non-vaccine serotypes</title>
<p>To investigate whether immunization with the M12-N, M12-C and M12-N+C could provide broad spectrum protection against non-vaccine serotypes, multiple GAS serotypes (M1, M2, M3, M4, M6, M12, M18, M28, M49, M50, M53) were chosen for opsonophagocytic killing (OPK) assay, as they are epidemiologically relevant and belong to different emm clusters. The antisera from M12-N or M12-C demonstrated varied levels of killing efficiency compared to the preimmune sera. The M12-N antiserum was capable of opsonizing the strains of M1, M3, M4, M5, M6, M18, M28, but no notable effect was observed on M2, M49, M50 or M53 (<xref ref-type="fig" rid="f5"><bold>Figure&#xa0;5</bold></xref>). The strains of M1, M3, M6, M12 and M18 were effectively opsonized and killed by the M12-C antiserum. The protective efficacy of the M12-N+C antiserum was relatively less pronounced compared to the M12-N antiserum administered individually, however, it demonstrated partial protection against the NZ131. It observed that the antiserum exhibited varying degrees of opsonophagocytic killing effects on M1, M3, M5, M18 and M28 as dose-dependent (data not shown). These results indicated that the differences in protection may be attributed to distinct antibody-mediated antigen recognition and binding to the GAS surface, which in turn influenced the subsequent initiation of phagocytosis. These results demonstrated that the bactericidal activities of the M12-N, M12-C and M12-N+C antisera were not limited to the M12 serotype.</p>
<fig id="f5" position="float">
<label>Figure&#xa0;5</label>
<caption>
<p>The opsonophagocytic killing assay of HL-60 cells using antisera against GAS. The OPK assay using GAS with antiserum (M12-N, M12-C, M12-N+C), specifically targeting the M peptides. The X-axis represented the groups in which the 3-fold diluted antiserum mediated the effects of multiple GAS serotypes, while the Y-axis denoted the percentage of killing. The two dashed lines corresponded to killing percentages of 35% and 70%, respectively. Each bar represented the mean value of three replicate measurements.</p>
</caption>
<graphic mimetype="image" mime-subtype="tiff" xlink:href="fimmu-16-1636591-g005.tif">
<alt-text content-type="machine-generated">Bar chart showing the percent of killing for various bacterial strains. Each group has three bars representing different conditions: M12-N, M12, and M12-N+C, color-coded in blue, red, and gray respectively. Error bars indicate variability. Strain labels (e.g., SF370, MGAS5005) are linked to types (e.g., M1, M2). Horizontal dashed lines are at 35 percent and 70 percent for reference.</alt-text>
</graphic></fig>
</sec>
</sec>
<sec id="s4" sec-type="discussion">
<label>4</label>
<title>Discussion</title>
<p>Previous researchers have confirmed the safety and efficacy of multiple M peptide vaccines (<xref ref-type="bibr" rid="B11">11</xref>&#x2013;<xref ref-type="bibr" rid="B17">17</xref>). The aim of this study was to develop an effective vaccine candidate that demonstrates strong protective efficacy against the predominant M12 serotype in China. They were derived from the N and C terminals of M12 protein. To increase the solubility and stability, a KSI sequence and a GS linker were added to the recombinant M peptide. KSI can function as a protein carrier, thereby augmenting the host immune response towards the target protein. The enhancements included a decrease in the molecular weight of the antigen, as well as improvements in antigen stability and immunogenicity. All three vaccine candidates elicited high levels of antigen-specific serum antibodies, particularly M12-C, which required only one booster to achieve the optimal titer. The level of serum antibody can be maintained even after GAS infection. We evaluated the efficacy of the vaccine candidates against infection and observed that all three were able to protect mice from MGAS9429 infection when compared with KSI-Alum or PBS-Alum. Notably, M12-C immunization significantly improved the survival rate and also protected against non-vaccine serotype MGAS5005 infection. These results demonstrate that the C-terminal of M12 protein, M12-C, is more effective in activating long-lasting immune responses and providing better protection against infection than either M12-N or M12-N+C. The original design intention of the fusion vaccine was to enable antibodies to provide protection against both the N and C termini, however, experimental results indicated otherwise. There may be mutual masking occurring within the fusion peptides, which hinders certain key epitopes from being fully accessible to the immune system. In contrast, epitopes derived from single sequence proteins are relatively straightforward and tend to be more readily recognized and bound by immune cells.</p>
<p>Compared to the recombinant full-length M protein vaccine, the M12 peptide vaccine eliminates cross-reactive antigenic sequences, thereby reducing the potential risk of rheumatic heart disease. In comparison with the M peptide vaccine J8-DT/Alum (MJ8Vax), the M12 peptide vaccine demonstrates a significantly enhanced protective efficacy against highly virulent <italic>cov</italic>R/S mutant strains. Furthermore, when compared to 26-valent and 30-valent N terminal vaccines, the M12 peptide vaccine markedly decreases the molecular weight of the antigen and achieves a protective coverage rate of 53.8% against non-vaccine serotypes.</p>
<p>The presence of Th1 type cytokine IFN-&#x3b3; suggests a potential role for Th1 responses in protecting against infection following vaccination (<xref ref-type="bibr" rid="B26">26</xref>&#x2013;<xref ref-type="bibr" rid="B28">28</xref>). However, the study did not show an enhanced Th2 type immune response represented by IL-4 secretion. This observation highlights the importance of Th1 responses, particularly IFN-&#x3b3;, in conferring protective immunity against GAS infections. In addition, the immune memory is capable of recalling each specific stimulus and initiating a secondary response that is both faster and stronger than the primary response. It has been observed that CD4<sup>+</sup> T cell memory can persist for at least 5 years (<xref ref-type="bibr" rid="B29">29</xref>, <xref ref-type="bibr" rid="B30">30</xref>). Following the third immunization, there was a significant increase in the proportion of effector memory T cells compared to the second immunization. The booster immunization served to stimulate long-lasting immunity. However, even in the absence of antigens, KSI plus aluminum adjuvant can facilitate Th1 cell activation and IFN-&#x3b3; secretion to some extent in this study. This may involve multiple immune regulatory mechanisms, particularly nonspecific activation of immune cells. Nevertheless, this activation effect failed to result in an improvement in protection in response to infection.</p>
<p>The distribution of prevalent GAS strains in China from 1990 to 2020 was investigated. A total of 8,820 GAS strains could be classified into 60 <italic>emm</italic> types (<xref ref-type="bibr" rid="B18">18</xref>). The most common GAS prevalent strains in China are <italic>emm</italic> 12 (59.28%) and <italic>emm</italic>1 (34.86%), accounting for 94.14% of all prevalent strains in total. Apart from <italic>emm</italic> 12 and <italic>emm</italic> 1, the top ten prevalent GAS strains also include <italic>emm</italic> 4, 22, 3, 75, 6, 18, 89 and 110 (<xref ref-type="bibr" rid="B18">18</xref>). To investigate whether immunization could provide broad spectrum protection against non-vaccine serotypes, we did a series of OPK assay, as those GAS serotypes are epidemiologically relevant and belong to different <italic>emm</italic> clusters. It observed that the antiserum exhibited varying degrees of opsonophagocytic killing effects on non-vaccine serotypes. These findings indicate that the antiserum not only provides protection against the M12 serotype but also exhibits protective effects against non-vaccine serotypes. This characteristic may represent a significant advantage in the development potential of the M12 peptide vaccine.</p>
<p>In conclusion, the M peptide vaccine derived from the C-terminal of the M12 protein exhibits more advantages compared to that derived from the N-terminal. Specifically, M12-C stands out as a promising candidate for a vaccine against the prevalent M12 serotype in China. Future research will focus on incorporating non-M protein epitopes, with the aim of developing highly immunogenic and effective vaccines that work synergistically to prevent multiple GAS serotypes.</p>
</sec>
</body>
<back>
<sec id="s5" sec-type="data-availability">
<title>Data availability statement</title>
<p>The original contributions presented in the study are included in the article/<xref ref-type="supplementary-material" rid="SM1"><bold>Supplementary Material</bold></xref>. Further inquiries can be directed to the corresponding author/s.</p></sec>
<sec id="s6" sec-type="ethics-statement">
<title>Ethics statement</title>
<p>Ethical approval was not required for the studies on humans in accordance with the local legislation and institutional requirements because only commercially available established cell lines were used. The animal study was approved by the Institutional Research Board of Harbin Medical University (Assurance Number: HMUIRB2024011). The study was conducted in accordance with the local legislation and institutional requirements.</p></sec>
<sec id="s7" sec-type="author-contributions">
<title>Author contributions</title>
<p>XZ: Supervision, Conceptualization, Methodology, Funding acquisition, Writing &#x2013; original draft, Formal Analysis. YM: Investigation, Data curation, Software, Writing &#x2013; original draft. RN: Resources, Writing &#x2013; original draft, Investigation. WH: Validation, Writing &#x2013; review &amp; editing, Visualization. EH: Writing &#x2013; review &amp; editing, Conceptualization, Funding acquisition. QZ: Supervision, Conceptualization, Writing &#x2013; review &amp; editing, Funding acquisition.</p></sec>
<sec id="s9" sec-type="COI-statement">
<title>Conflict of interest</title>
<p>Authors WH was employed by Chengdu Ruiyi Biotechnology Co., Ltd.</p>
<p>The remaining authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.</p></sec>
<sec id="s10" sec-type="ai-statement">
<title>Generative AI statement</title>
<p>The author(s) declare that no Generative AI was used in the creation of this manuscript.</p>
<p>Any alternative text (alt text) provided alongside figures in this article has been generated by Frontiers with the support of artificial intelligence and reasonable efforts have been made to ensure accuracy, including review by the authors wherever possible. If you identify any issues, please contact us.</p></sec>
<sec id="s11" sec-type="disclaimer">
<title>Publisher&#x2019;s note</title>
<p>All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.</p></sec>
<sec id="s12" sec-type="supplementary-material">
<title>Supplementary material</title>
<p>The Supplementary Material for this article can be found online at: <ext-link ext-link-type="uri" xlink:href="https://www.frontiersin.org/articles/10.3389/fimmu.2025.1636591/full#supplementary-material">https://www.frontiersin.org/articles/10.3389/fimmu.2025.1636591/full#supplementary-material</ext-link></p>
<supplementary-material xlink:href="DataSheet1.pdf" id="SM1" mimetype="application/pdf"/></sec>
<ref-list>
<title>References</title>
<ref id="B1">
<label>1</label>
<mixed-citation publication-type="journal">
<person-group person-group-type="author">
<name><surname>Walker</surname> <given-names>MJ</given-names></name>
<name><surname>Barnett</surname> <given-names>TC</given-names></name>
<name><surname>McArthur</surname> <given-names>JD</given-names></name>
<name><surname>Cole</surname> <given-names>JN</given-names></name>
<name><surname>Gillen</surname> <given-names>CM</given-names></name>
<name><surname>Henningham</surname> <given-names>A</given-names></name>
<etal/>
</person-group>. 
<article-title>Disease manifestations and pathogenic mechanisms of group A Streptococcus</article-title>. <source>Clin Microbiol Rev</source>. (<year>2014</year>) <volume>27</volume>:<fpage>264</fpage>&#x2013;<lpage>301</lpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1128/CMR.00101-13</pub-id>, PMID: <pub-id pub-id-type="pmid">24696436</pub-id>
</mixed-citation>
</ref>
<ref id="B2">
<label>2</label>
<mixed-citation publication-type="journal">
<person-group person-group-type="author">
<name><surname>Moore</surname> <given-names>HC</given-names></name>
<name><surname>Cannon</surname> <given-names>JW</given-names></name>
<name><surname>Kaslow</surname> <given-names>DC</given-names></name>
<name><surname>Lamagni</surname> <given-names>T</given-names></name>
<name><surname>Bowen</surname> <given-names>AC</given-names></name>
<name><surname>Miller</surname> <given-names>KM</given-names></name>
<etal/>
</person-group>. 
<article-title>A systematic framework for prioritizing burden of disease data required for vaccine development and implementation: the case for group A streptococcal diseases</article-title>. <source>Clin Infect Dis</source>. (<year>2022</year>) <volume>75</volume>:<page-range>1245&#x2013;54</page-range>. doi:&#xa0;<pub-id pub-id-type="doi">10.1093/cid/ciac291</pub-id>, PMID: <pub-id pub-id-type="pmid">35438130</pub-id>
</mixed-citation>
</ref>
<ref id="B3">
<label>3</label>
<mixed-citation publication-type="journal">
<person-group person-group-type="author">
<name><surname>Tortorice</surname> <given-names>D</given-names></name>
<name><surname>Ferranna</surname> <given-names>M</given-names></name>
<name><surname>Bloom</surname> <given-names>DE</given-names></name>
</person-group>. 
<article-title>Optimal global spending for group A Streptococcus vaccine research and development</article-title>. <source>NPJ Vaccines</source>. (<year>2023</year>) <volume>8</volume>:<fpage>62</fpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1038/s41541-023-00646-6</pub-id>, PMID: <pub-id pub-id-type="pmid">37185380</pub-id>
</mixed-citation>
</ref>
<ref id="B4">
<label>4</label>
<mixed-citation publication-type="journal">
<person-group person-group-type="author">
<name><surname>Ozberk</surname> <given-names>V</given-names></name>
<name><surname>Reynolds</surname> <given-names>S</given-names></name>
<name><surname>Huo</surname> <given-names>Y</given-names></name>
<name><surname>Calcutt</surname> <given-names>A</given-names></name>
<name><surname>Eskandari</surname> <given-names>S</given-names></name>
<name><surname>Dooley</surname> <given-names>J</given-names></name>
<etal/>
</person-group>. 
<article-title>Prime-Pull Immunization with a Bivalent M-Protein and Spy-CEP Peptide Vaccine Adjuvanted with CAF<sup>&#xae;</sup>01 Liposomes Induces Both Mucosal and Peripheral Protection from <italic>covR/S</italic> Mutant Streptococcus pyogenes</article-title>. <source>mBio</source>. (<year>2021</year>) <volume>12</volume>:<page-range>e03537&#x2013;20</page-range>. doi:&#xa0;<pub-id pub-id-type="doi">10.1128/mBio.03537-20</pub-id>, PMID: <pub-id pub-id-type="pmid">33622722</pub-id>
</mixed-citation>
</ref>
<ref id="B5">
<label>5</label>
<mixed-citation publication-type="journal">
<person-group person-group-type="author">
<name><surname>Wang</surname> <given-names>J</given-names></name>
<name><surname>Ma</surname> <given-names>C</given-names></name>
<name><surname>Li</surname> <given-names>M</given-names></name>
<name><surname>Gao</surname> <given-names>X</given-names></name>
<name><surname>Wu</surname> <given-names>H</given-names></name>
<name><surname>Dong</surname> <given-names>W</given-names></name>
<etal/>
</person-group>. 
<article-title>Streptococcus pyogenes: pathogenesis and the current status of vaccines</article-title>. <source>Vaccines</source>. (<year>2023</year>) <volume>11</volume>:<fpage>1510</fpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.3390/vaccines11091510</pub-id>, PMID: <pub-id pub-id-type="pmid">37766186</pub-id>
</mixed-citation>
</ref>
<ref id="B6">
<label>6</label>
<mixed-citation publication-type="journal">
<person-group person-group-type="author">
<name><surname>Asturias</surname> <given-names>EJ</given-names></name>
<name><surname>Excler</surname> <given-names>J-L</given-names></name>
<name><surname>Ackland</surname> <given-names>J</given-names></name>
<name><surname>Cavaleri</surname> <given-names>M</given-names></name>
<name><surname>Fulurija</surname> <given-names>A</given-names></name>
<name><surname>Long</surname> <given-names>R</given-names></name>
<etal/>
</person-group>. 
<article-title>Safety of streptococcus pyogenes vaccines: anticipating and overcoming challenges for clinical trials and post-marketing monitoring</article-title>. <source>Clin Infect Dis</source>. (<year>2023</year>) <volume>77</volume>:<page-range>917&#x2013;24</page-range>. doi:&#xa0;<pub-id pub-id-type="doi">10.1093/cid/ciad311</pub-id>, PMID: <pub-id pub-id-type="pmid">37232372</pub-id>
</mixed-citation>
</ref>
<ref id="B7">
<label>7</label>
<mixed-citation publication-type="journal">
<person-group person-group-type="author">
<name><surname>McNeil</surname> <given-names>SA</given-names></name>
<name><surname>Halperin</surname> <given-names>SA</given-names></name>
<name><surname>Langley</surname> <given-names>JM</given-names></name>
<name><surname>Smith</surname> <given-names>B</given-names></name>
<name><surname>Warren</surname> <given-names>A</given-names></name>
<name><surname>Sharratt</surname> <given-names>GP</given-names></name>
<etal/>
</person-group>. 
<article-title>Safety and immunogenicity of 26-valent group a streptococcus vaccine in healthy adult volunteers</article-title>. <source>Clin Infect Dis</source>. (<year>2005</year>) <volume>41</volume>:<page-range>1114&#x2013;22</page-range>. doi:&#xa0;<pub-id pub-id-type="doi">10.1086/444458</pub-id>, PMID: <pub-id pub-id-type="pmid">16163629</pub-id>
</mixed-citation>
</ref>
<ref id="B8">
<label>8</label>
<mixed-citation publication-type="journal">
<person-group person-group-type="author">
<name><surname>Massell</surname> <given-names>BF</given-names></name>
<name><surname>Honikman</surname> <given-names>LH</given-names></name>
<name><surname>Amezcua</surname> <given-names>J</given-names></name>
</person-group>. 
<article-title>Rheumatic fever following streptococcal vaccination. Report of three cases</article-title>. <source>JAMA</source>. (<year>1969</year>) <volume>207</volume>:<page-range>1115&#x2013;9</page-range>. doi:&#xa0;<pub-id pub-id-type="doi">10.1001/jama.1969.03150190037007</pub-id>, PMID: <pub-id pub-id-type="pmid">5818242</pub-id>
</mixed-citation>
</ref>
<ref id="B9">
<label>9</label>
<mixed-citation publication-type="journal">
<person-group person-group-type="author">
<name><surname>Fox</surname> <given-names>EN</given-names></name>
<name><surname>Waldman</surname> <given-names>RH</given-names></name>
<name><surname>Wittner</surname> <given-names>MK</given-names></name>
<name><surname>Mauceri</surname> <given-names>AA</given-names></name>
<name><surname>Dorfman</surname> <given-names>A</given-names></name>
</person-group>. 
<article-title>Protective study with a group A streptococcal M protein vaccine. Infectivity challenge of human volunteers</article-title>. <source>J Clin Invest</source>. (<year>1973</year>) <volume>52</volume>:<page-range>1885&#x2013;92</page-range>. doi:&#xa0;<pub-id pub-id-type="doi">10.1172/JCI107372</pub-id>, PMID: <pub-id pub-id-type="pmid">4719668</pub-id>
</mixed-citation>
</ref>
<ref id="B10">
<label>10</label>
<mixed-citation publication-type="journal">
<person-group person-group-type="author">
<name><surname>Quinn</surname> <given-names>A</given-names></name>
<name><surname>Kosanke</surname> <given-names>S</given-names></name>
<name><surname>Fischetti</surname> <given-names>VA</given-names></name>
<name><surname>Factor</surname> <given-names>SM</given-names></name>
<name><surname>Cunningham</surname> <given-names>MW</given-names></name>
</person-group>. 
<article-title>Induction of autoimmune valvular heart disease by recombinant streptococcal m protein</article-title>. <source>Infecti Immun</source>. (<year>2001</year>) <volume>69</volume>:<page-range>4072&#x2013;8</page-range>. doi:&#xa0;<pub-id pub-id-type="doi">10.1128/IAI.69.6.4072-4078.2001</pub-id>, PMID: <pub-id pub-id-type="pmid">11349078</pub-id>
</mixed-citation>
</ref>
<ref id="B11">
<label>11</label>
<mixed-citation publication-type="journal">
<person-group person-group-type="author">
<name><surname>de S&#xe1;-Rocha</surname> <given-names>LC</given-names></name>
<name><surname>Maria MF Demarchi</surname> <given-names>L</given-names></name>
<name><surname>Postol</surname> <given-names>E</given-names></name>
<name><surname>Sampaio</surname> <given-names>RO</given-names></name>
<name><surname>de Alencar</surname> <given-names>RE</given-names></name>
<name><surname>Kalil</surname> <given-names>J</given-names></name>
<etal/>
</person-group>. 
<article-title>StreptInCor, a group A streptococcal adsorbed vaccine: evaluation of repeated intramuscular dose toxicity testing in rats</article-title>. <source>Front Cardiovasc Med</source>. (<year>2021</year>) <volume>8</volume>:<elocation-id>643317</elocation-id>. doi:&#xa0;<pub-id pub-id-type="doi">10.3389/fcvm.2021.643317</pub-id>, PMID: <pub-id pub-id-type="pmid">34046438</pub-id>
</mixed-citation>
</ref>
<ref id="B12">
<label>12</label>
<mixed-citation publication-type="journal">
<person-group person-group-type="author">
<name><surname>Postol</surname> <given-names>E</given-names></name>
<name><surname>Alencar</surname> <given-names>R</given-names></name>
<name><surname>Higa</surname> <given-names>FT</given-names></name>
<name><surname>de Barros</surname> <given-names>SF</given-names></name>
<name><surname>Demarchi</surname> <given-names>LMF</given-names></name>
<name><surname>Kalil</surname> <given-names>J</given-names></name>
<etal/>
</person-group>. 
<article-title>StreptInCor: a candidate vaccine epitope against S. pyogenes infections induces protection in outbred mice</article-title>. <source>PloS One</source>. (<year>2013</year>) <volume>8</volume>:<elocation-id>e60969</elocation-id>. doi:&#xa0;<pub-id pub-id-type="doi">10.1371/journal.pone.0060969</pub-id>, PMID: <pub-id pub-id-type="pmid">23593359</pub-id>
</mixed-citation>
</ref>
<ref id="B13">
<label>13</label>
<mixed-citation publication-type="journal">
<person-group person-group-type="author">
<name><surname>Campbell</surname> <given-names>PT</given-names></name>
<name><surname>Frost</surname> <given-names>H</given-names></name>
<name><surname>Smeesters</surname> <given-names>PR</given-names></name>
<name><surname>Kado</surname> <given-names>J</given-names></name>
<name><surname>Good</surname> <given-names>MF</given-names></name>
<name><surname>Batzloff</surname> <given-names>M</given-names></name>
<etal/>
</person-group>. 
<article-title>Investigation of group A Streptococcus immune responses in an endemic setting, with a particular focus on J8</article-title>. <source>Vaccine</source>. (<year>2018</year>) <volume>36</volume>:<page-range>7618&#x2013;24</page-range>. doi:&#xa0;<pub-id pub-id-type="doi">10.1016/j.vaccine.2018.10.091</pub-id>, PMID: <pub-id pub-id-type="pmid">30401621</pub-id>
</mixed-citation>
</ref>
<ref id="B14">
<label>14</label>
<mixed-citation publication-type="journal">
<person-group person-group-type="author">
<name><surname>Ozberk</surname> <given-names>V</given-names></name>
<name><surname>Pandey</surname> <given-names>M</given-names></name>
<name><surname>Good</surname> <given-names>MF</given-names></name>
</person-group>. 
<article-title>Contribution of cryptic epitopes in designing a group A streptococcal vaccine</article-title>. <source>Hum Vaccines Immunother</source>. (<year>2018</year>) <volume>14</volume>:<page-range>2034&#x2013;52</page-range>. doi:&#xa0;<pub-id pub-id-type="doi">10.1080/21645515.2018.1462427</pub-id>, PMID: <pub-id pub-id-type="pmid">29873591</pub-id>
</mixed-citation>
</ref>
<ref id="B15">
<label>15</label>
<mixed-citation publication-type="journal">
<person-group person-group-type="author">
<name><surname>Hu</surname> <given-names>MC</given-names></name>
<name><surname>Walls</surname> <given-names>MA</given-names></name>
<name><surname>Stroop</surname> <given-names>SD</given-names></name>
<name><surname>Reddish</surname> <given-names>MA</given-names></name>
<name><surname>Beall</surname> <given-names>B</given-names></name>
<name><surname>Dale</surname> <given-names>JB</given-names></name>
</person-group>. 
<article-title>Immunogenicity of a 26-valent group A streptococcal vaccine</article-title>. <source>Infecti Immun</source>. (<year>2002</year>) <volume>70</volume>:<page-range>2171&#x2013;7</page-range>. doi:&#xa0;<pub-id pub-id-type="doi">10.1128/IAI.70.4.2171-2177.2002</pub-id>, PMID: <pub-id pub-id-type="pmid">11895984</pub-id>
</mixed-citation>
</ref>
<ref id="B16">
<label>16</label>
<mixed-citation publication-type="journal">
<person-group person-group-type="author">
<name><surname>Dale</surname> <given-names>JB</given-names></name>
<name><surname>Penfound</surname> <given-names>TA</given-names></name>
<name><surname>Chiang</surname> <given-names>EY</given-names></name>
<name><surname>Walton</surname> <given-names>WJ</given-names></name>
</person-group>. 
<article-title>New 30-valent M protein-based vaccine evokes cross-opsonic antibodies against non-vaccine serotypes of group A Streptococci</article-title>. <source>Vaccine</source>. (<year>2011</year>) <volume>29</volume>:<page-range>8175&#x2013;8</page-range>. doi:&#xa0;<pub-id pub-id-type="doi">10.1016/j.vaccine.2011.09.005</pub-id>, PMID: <pub-id pub-id-type="pmid">21920403</pub-id>
</mixed-citation>
</ref>
<ref id="B17">
<label>17</label>
<mixed-citation publication-type="journal">
<person-group person-group-type="author">
<name><surname>Finn</surname> <given-names>MB</given-names></name>
<name><surname>Penfound</surname> <given-names>TA</given-names></name>
<name><surname>Salehi</surname> <given-names>S</given-names></name>
<name><surname>Ogega</surname> <given-names>CO</given-names></name>
<name><surname>Dold</surname> <given-names>C</given-names></name>
<name><surname>Plante</surname> <given-names>O</given-names></name>
<etal/>
</person-group>. 
<article-title>Immunogenicity of a 30-valent M protein mRNA group A Streptococcus vaccine</article-title>. <source>Vaccine</source>. (<year>2024</year>) <volume>42</volume>:<fpage>126205</fpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1016/j.vaccine.2024.126205</pub-id>, PMID: <pub-id pub-id-type="pmid">39141987</pub-id>
</mixed-citation>
</ref>
<ref id="B18">
<label>18</label>
<mixed-citation publication-type="journal">
<person-group person-group-type="author">
<name><surname>Xiang</surname> <given-names>C</given-names></name>
<name><surname>Zhang</surname> <given-names>J</given-names></name>
<name><surname>Zhao</surname> <given-names>F</given-names></name>
<name><surname>You</surname> <given-names>Y</given-names></name>
</person-group>. 
<article-title>Emm type distribution of group A Streptococcus in China during 1990 and 2020: a systematic review and implications for vaccine coverage</article-title>. <source>Front Public Health</source>. (<year>2023</year>) <volume>11</volume>:<elocation-id>1157289</elocation-id>. doi:&#xa0;<pub-id pub-id-type="doi">10.3389/fpubh.2023.1157289</pub-id>, PMID: <pub-id pub-id-type="pmid">37325303</pub-id>
</mixed-citation>
</ref>
<ref id="B19">
<label>19</label>
<mixed-citation publication-type="journal">
<person-group person-group-type="author">
<name><surname>Rivera-Hernandez</surname> <given-names>T</given-names></name>
<name><surname>Pandey</surname> <given-names>M</given-names></name>
<name><surname>Henningham</surname> <given-names>A</given-names></name>
<name><surname>Cole</surname> <given-names>J</given-names></name>
<name><surname>Choudhury</surname> <given-names>B</given-names></name>
<name><surname>Cork</surname> <given-names>AJ</given-names></name>
<etal/>
</person-group>. 
<article-title>Differing efficacies of lead group A streptococcal vaccine candidates and full-length M protein in cutaneous and invasive disease models</article-title>. <source>mBio</source>. (<year>2016</year>) <volume>7</volume>:<page-range>e00618&#x2013;16</page-range>. doi:&#xa0;<pub-id pub-id-type="doi">10.1128/mBio.00618-16</pub-id>, PMID: <pub-id pub-id-type="pmid">27302756</pub-id>
</mixed-citation>
</ref>
<ref id="B20">
<label>20</label>
<mixed-citation publication-type="journal">
<person-group person-group-type="author">
<name><surname>Zhang</surname> <given-names>X</given-names></name>
<name><surname>Zhao</surname> <given-names>Y</given-names></name>
<name><surname>Wang</surname> <given-names>Y</given-names></name>
<name><surname>Cai</surname> <given-names>M</given-names></name>
<name><surname>Song</surname> <given-names>Y</given-names></name>
<name><surname>Zhu</surname> <given-names>H</given-names></name>
</person-group>. 
<article-title>Attenuation of virulence in multiple serotypes (M1, M3, and M28) of group A Streptococcus after the loss of secreted esterase</article-title>. <source>J Microbiol Immunol Infect</source>. (<year>2022</year>) <volume>55</volume>:<page-range>662&#x2013;70</page-range>. doi:&#xa0;<pub-id pub-id-type="doi">10.1016/j.jmii.2021.09.008</pub-id>, PMID: <pub-id pub-id-type="pmid">34674958</pub-id>
</mixed-citation>
</ref>
<ref id="B21">
<label>21</label>
<mixed-citation publication-type="journal">
<person-group person-group-type="author">
<name><surname>Zhang</surname> <given-names>X</given-names></name>
<name><surname>Wei</surname> <given-names>D</given-names></name>
<name><surname>Zhao</surname> <given-names>Y</given-names></name>
<name><surname>Zhong</surname> <given-names>Z</given-names></name>
<name><surname>Wang</surname> <given-names>Y</given-names></name>
<name><surname>Song</surname> <given-names>Y</given-names></name>
<etal/>
</person-group>. 
<article-title>Immunization with a secreted esterase protects mice against multiple serotypes (M1, M3, and M28) of group A Streptococcus</article-title>. <source>Front Microbiol</source>. (<year>2020</year>) <volume>11</volume>:<elocation-id>565</elocation-id>. doi:&#xa0;<pub-id pub-id-type="doi">10.3389/fmicb.2020.00565</pub-id>, PMID: <pub-id pub-id-type="pmid">32308652</pub-id>
</mixed-citation>
</ref>
<ref id="B22">
<label>22</label>
<mixed-citation publication-type="journal">
<person-group person-group-type="author">
<name><surname>Salehi</surname> <given-names>S</given-names></name>
<name><surname>Hohn</surname> <given-names>CM</given-names></name>
<name><surname>Penfound</surname> <given-names>TA</given-names></name>
<name><surname>Dale</surname> <given-names>JB</given-names></name>
</person-group>. 
<article-title>Development of an Opsonophagocytic Killing Assay Using HL-60 Cells for Detection of Functional Antibodies against Streptococcus pyogenes</article-title>. <source>mSphere</source>. (<year>2018</year>) <volume>3</volume>:<elocation-id>e00617-18</elocation-id>. doi:&#xa0;<pub-id pub-id-type="doi">10.1128/mSphere.00617-18</pub-id>, PMID: <pub-id pub-id-type="pmid">30567901</pub-id>
</mixed-citation>
</ref>
<ref id="B23">
<label>23</label>
<mixed-citation publication-type="journal">
<person-group person-group-type="author">
<name><surname>McGregor</surname> <given-names>R</given-names></name>
<name><surname>Jones</surname> <given-names>S</given-names></name>
<name><surname>Jeremy</surname> <given-names>RM</given-names></name>
<name><surname>Goldblatt</surname> <given-names>D</given-names></name>
<name><surname>Moreland</surname> <given-names>NJ</given-names></name>
</person-group>. 
<article-title>An opsonophagocytic killing assay for the evaluation of group A streptococcus vaccine antisera</article-title>. <source>Methods Mol Biol (Clifton NJ)</source>. (<year>2020</year>) <volume>2136</volume>:<page-range>323&#x2013;35</page-range>. doi:&#xa0;<pub-id pub-id-type="doi">10.1007/978-1-0716-0467-0_26</pub-id>, PMID: <pub-id pub-id-type="pmid">32430834</pub-id>
</mixed-citation>
</ref>
<ref id="B24">
<label>24</label>
<mixed-citation publication-type="journal">
<person-group person-group-type="author">
<name><surname>Snapper</surname> <given-names>CM</given-names></name>
<name><surname>Paul</surname> <given-names>WE</given-names></name>
</person-group>. 
<article-title>Interferon-gamma and B cell stimulatory factor-1 reciprocally regulate Ig isotype production</article-title>. <source>Science</source>. (<year>1987</year>) <volume>236</volume>:<page-range>944&#x2013;7</page-range>. doi:&#xa0;<pub-id pub-id-type="doi">10.1126/science.3107127</pub-id>, PMID: <pub-id pub-id-type="pmid">3107127</pub-id>
</mixed-citation>
</ref>
<ref id="B25">
<label>25</label>
<mixed-citation publication-type="journal">
<person-group person-group-type="author">
<name><surname>Barr</surname> <given-names>TA</given-names></name>
<name><surname>Brown</surname> <given-names>S</given-names></name>
<name><surname>Mastroeni</surname> <given-names>P</given-names></name>
<name><surname>Gray</surname> <given-names>D</given-names></name>
</person-group>. 
<article-title>B cell intrinsic MyD88 signals drive IFN-gamma production from T cells and control switching to IgG2c</article-title>. <source>J Immunol</source>. (<year>2009</year>) <volume>183</volume>:<page-range>1005&#x2013;12</page-range>. doi:&#xa0;<pub-id pub-id-type="doi">10.4049/jimmunol.0803706</pub-id>, PMID: <pub-id pub-id-type="pmid">19542370</pub-id>
</mixed-citation>
</ref>
<ref id="B26">
<label>26</label>
<mixed-citation publication-type="journal">
<person-group person-group-type="author">
<name><surname>Liu</surname> <given-names>L</given-names></name>
<name><surname>Cai</surname> <given-names>P</given-names></name>
<name><surname>Gu</surname> <given-names>W</given-names></name>
<name><surname>Duan</surname> <given-names>X</given-names></name>
<name><surname>Gao</surname> <given-names>S</given-names></name>
<name><surname>Ma</surname> <given-names>X</given-names></name>
<etal/>
</person-group>. 
<article-title>Evaluation of vaccine candidates against Rhodococcus equi in BALB/c mice infection model: cellular and humoral immune responses</article-title>. <source>BMC Microbiol</source>. (<year>2024</year>) <volume>24</volume>:<fpage>249</fpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1186/s12866-024-03408-z</pub-id>, PMID: <pub-id pub-id-type="pmid">38977999</pub-id>
</mixed-citation>
</ref>
<ref id="B27">
<label>27</label>
<mixed-citation publication-type="journal">
<person-group person-group-type="author">
<name><surname>Emami</surname> <given-names>S</given-names></name>
<name><surname>Converso</surname> <given-names>TR</given-names></name>
<name><surname>Persson</surname> <given-names>JJ</given-names></name>
<name><surname>Johansson-Lindbom</surname> <given-names>B</given-names></name>
</person-group>. 
<article-title>Insertion of an immunodominant T helper cell epitope within the Group A Streptococcus M protein promotes an IFN-&#x3b3;-dependent shift from a non-protective to a protective immune response</article-title>. <source>Front Immunol</source>. (<year>2023</year>) <volume>14</volume>:<elocation-id>1241485</elocation-id>. doi:&#xa0;<pub-id pub-id-type="doi">10.3389/fimmu.2023.1241485</pub-id>, PMID: <pub-id pub-id-type="pmid">37654501</pub-id>
</mixed-citation>
</ref>
<ref id="B28">
<label>28</label>
<mixed-citation publication-type="journal">
<person-group person-group-type="author">
<name><surname>Tahsin</surname> <given-names>A</given-names></name>
<name><surname>Bhattacharjee</surname> <given-names>P</given-names></name>
<name><surname>Al Saba</surname> <given-names>A</given-names></name>
<name><surname>Yasmin</surname> <given-names>T</given-names></name>
<name><surname>Nurun Nabi</surname> <given-names>AHM</given-names></name>
</person-group>. 
<article-title>Genetic and epigenetic analyses of IFN-&#x3b3; gene proximal promoter region underlying positive correlation between persistently high anti-SARS-CoV-2 IgG and IFN-&#x3b3; among COVID-19 vaccinated Bangladeshi adults</article-title>. <source>Vaccine</source>. (<year>2024</year>) <volume>42</volume>:<fpage>126157</fpage>. doi:&#xa0;<pub-id pub-id-type="doi">10.1016/j.vaccine.2024.126157</pub-id>, PMID: <pub-id pub-id-type="pmid">39079811</pub-id>
</mixed-citation>
</ref>
<ref id="B29">
<label>29</label>
<mixed-citation publication-type="journal">
<person-group person-group-type="author">
<name><surname>K&#xfc;nzli</surname> <given-names>M</given-names></name>
<name><surname>Masopust</surname> <given-names>D</given-names></name>
</person-group>. 
<article-title>CD4<sup>+</sup> T cell memory</article-title>. <source>Nat Immunol</source>. (<year>2023</year>) <volume>24</volume>:<page-range>903&#x2013;14</page-range>. doi:&#xa0;<pub-id pub-id-type="doi">10.1038/s41590-023-01510-4</pub-id>, PMID: <pub-id pub-id-type="pmid">37156885</pub-id>
</mixed-citation>
</ref>
<ref id="B30">
<label>30</label>
<mixed-citation publication-type="journal">
<person-group person-group-type="author">
<name><surname>Fazeli</surname> <given-names>P</given-names></name>
<name><surname>Kalani</surname> <given-names>M</given-names></name>
<name><surname>Hosseini</surname> <given-names>M</given-names></name>
</person-group>. 
<article-title>T memory stem cell characteristics in autoimmune diseases and their promising therapeutic values</article-title>. <source>Front Immunol</source>. (<year>2023</year>) <volume>14</volume>:<elocation-id>1204231</elocation-id>. doi:&#xa0;<pub-id pub-id-type="doi">10.3389/fimmu.2023.1204231</pub-id>, PMID: <pub-id pub-id-type="pmid">37497231</pub-id>
</mixed-citation>
</ref>
</ref-list>
<fn-group>
<fn id="n1" fn-type="custom" custom-type="edited-by">
<p>Edited by: <ext-link ext-link-type="uri" xlink:href="https://loop.frontiersin.org/people/1989962">Bingdong Zhu</ext-link>, Lanzhou University, China</p></fn>
<fn id="n2" fn-type="custom" custom-type="reviewed-by">
<p>Reviewed by: <ext-link ext-link-type="uri" xlink:href="https://loop.frontiersin.org/people/243109">Andrea L Herrera</ext-link>, University of South Dakota, United States</p>
<p><ext-link ext-link-type="uri" xlink:href="https://loop.frontiersin.org/people/318960">Victor C Huber</ext-link>, University of South Dakota, United States</p>
<p><ext-link ext-link-type="uri" xlink:href="https://loop.frontiersin.org/people/1545223">Sebastian Wrighton</ext-link>, Medical University of Vienna, Austria</p></fn>
</fn-group>
</back>
</article>