<?xml version="1.0" encoding="UTF-8"?>
<!DOCTYPE article PUBLIC "-//NLM//DTD Journal Publishing DTD v2.3 20070202//EN" "journalpublishing.dtd">
<?covid-19-tdm?>
<article article-type="review-article" dtd-version="2.3" xml:lang="EN" xmlns:mml="http://www.w3.org/1998/Math/MathML" xmlns:xlink="http://www.w3.org/1999/xlink">
<front>
<journal-meta>
<journal-id journal-id-type="publisher-id">Front. Chem.</journal-id>
<journal-title>Frontiers in Chemistry</journal-title>
<abbrev-journal-title abbrev-type="pubmed">Front. Chem.</abbrev-journal-title>
<issn pub-type="epub">2296-2646</issn>
<publisher>
<publisher-name>Frontiers Media S.A.</publisher-name>
</publisher>
</journal-meta>
<article-meta>
<article-id pub-id-type="publisher-id">1597656</article-id>
<article-id pub-id-type="doi">10.3389/fchem.2025.1597656</article-id>
<article-categories>
<subj-group subj-group-type="heading">
<subject>Chemistry</subject>
<subj-group>
<subject>Review</subject>
</subj-group>
</subj-group>
</article-categories>
<title-group>
<article-title>The role of intrinsically disordered regions of SARS-CoV-2 nucleocapsid and non-structural protein 1 proteins</article-title>
<alt-title alt-title-type="left-running-head">Shitaye et al.</alt-title>
<alt-title alt-title-type="right-running-head">
<ext-link ext-link-type="uri" xlink:href="https://doi.org/10.3389/fchem.2025.1597656">10.3389/fchem.2025.1597656</ext-link>
</alt-title>
</title-group>
<contrib-group>
<contrib contrib-type="author">
<name>
<surname>Shitaye</surname>
<given-names>Getasew</given-names>
</name>
<xref ref-type="aff" rid="aff1">
<sup>1</sup>
</xref>
<xref ref-type="aff" rid="aff2">
<sup>2</sup>
</xref>
<uri xlink:href="https://loop.frontiersin.org/people/3012141/overview"/>
<role content-type="https://credit.niso.org/contributor-roles/writing-original-draft/"/>
</contrib>
<contrib contrib-type="author">
<name>
<surname>Ventserova</surname>
<given-names>Nataliia</given-names>
</name>
<xref ref-type="aff" rid="aff1">
<sup>1</sup>
</xref>
<uri xlink:href="https://loop.frontiersin.org/people/3062136/overview"/>
<role content-type="https://credit.niso.org/contributor-roles/writing-original-draft/"/>
</contrib>
<contrib contrib-type="author">
<name>
<surname>D&#x2019;Abrosca</surname>
<given-names>Gianluca</given-names>
</name>
<xref ref-type="aff" rid="aff3">
<sup>3</sup>
</xref>
<uri xlink:href="https://loop.frontiersin.org/people/1053288/overview"/>
<role content-type="https://credit.niso.org/contributor-roles/writing-original-draft/"/>
</contrib>
<contrib contrib-type="author">
<name>
<surname>Dragone</surname>
<given-names>Martina</given-names>
</name>
<xref ref-type="aff" rid="aff1">
<sup>1</sup>
</xref>
<uri xlink:href="https://loop.frontiersin.org/people/3090223/overview"/>
<role content-type="https://credit.niso.org/contributor-roles/writing-original-draft/"/>
</contrib>
<contrib contrib-type="author">
<name>
<surname>Maina</surname>
<given-names>Eunice Wairimu</given-names>
</name>
<xref ref-type="aff" rid="aff1">
<sup>1</sup>
</xref>
<uri xlink:href="https://loop.frontiersin.org/people/3076320/overview"/>
<role content-type="https://credit.niso.org/contributor-roles/writing-original-draft/"/>
</contrib>
<contrib contrib-type="author">
<name>
<surname>Fattorusso</surname>
<given-names>Roberto</given-names>
</name>
<xref ref-type="aff" rid="aff1">
<sup>1</sup>
</xref>
<uri xlink:href="https://loop.frontiersin.org/people/1045508/overview"/>
<role content-type="https://credit.niso.org/contributor-roles/Writing - review &#x26; editing/"/>
</contrib>
<contrib contrib-type="author">
<name>
<surname>Iacovino</surname>
<given-names>Rosa</given-names>
</name>
<xref ref-type="aff" rid="aff1">
<sup>1</sup>
</xref>
<uri xlink:href="https://loop.frontiersin.org/people/3090254/overview"/>
<role content-type="https://credit.niso.org/contributor-roles/Writing - review &#x26; editing/"/>
</contrib>
<contrib contrib-type="author">
<name>
<surname>Russo</surname>
<given-names>Luigi</given-names>
</name>
<xref ref-type="aff" rid="aff1">
<sup>1</sup>
</xref>
<uri xlink:href="https://loop.frontiersin.org/people/1148813/overview"/>
<role content-type="https://credit.niso.org/contributor-roles/Writing - review &#x26; editing/"/>
</contrib>
<contrib contrib-type="author" corresp="yes">
<name>
<surname>Isernia</surname>
<given-names>Carla</given-names>
</name>
<xref ref-type="aff" rid="aff1">
<sup>1</sup>
</xref>
<xref ref-type="aff" rid="aff4">
<sup>4</sup>
</xref>
<xref ref-type="corresp" rid="c001">&#x2a;</xref>
<uri xlink:href="https://loop.frontiersin.org/people/3062165/overview"/>
<role content-type="https://credit.niso.org/contributor-roles/Writing - review &#x26; editing/"/>
</contrib>
<contrib contrib-type="author" corresp="yes">
<name>
<surname>Malgieri</surname>
<given-names>Gaetano</given-names>
</name>
<xref ref-type="aff" rid="aff1">
<sup>1</sup>
</xref>
<xref ref-type="aff" rid="aff4">
<sup>4</sup>
</xref>
<xref ref-type="corresp" rid="c001">&#x2a;</xref>
<uri xlink:href="https://loop.frontiersin.org/people/3011718/overview"/>
<role content-type="https://credit.niso.org/contributor-roles/Writing - review &#x26; editing/"/>
<role content-type="https://credit.niso.org/contributor-roles/funding-acquisition/"/>
</contrib>
</contrib-group>
<aff id="aff1">
<sup>1</sup>
<institution>Department of Environmental, Biological and Pharmaceutical Sciences and Technologies</institution>, <institution>University of Campania &#x201c;Luigi Vanvitelli&#x201d;</institution>, <addr-line>Caserta</addr-line>, <country>Italy</country>
</aff>
<aff id="aff2">
<sup>2</sup>
<institution>Department of Biomedical Sciences</institution>, <institution>College of Medicine and Health Sciences</institution>, <institution>Bahir Dar University</institution>, <addr-line>Bahir Dar</addr-line>, <country>Ethiopia</country>
</aff>
<aff id="aff3">
<sup>3</sup>
<institution>Department of Human Sciences</institution>, <institution>Link Campus University</institution>, <addr-line>Roma</addr-line>, <country>Italy</country>
</aff>
<aff id="aff4">
<sup>4</sup>
<institution>Interuniversity Research Centre on Bioactive Peptides</institution>, <institution>University of Naples &#x201c;Federico II&#x201d;</institution>, <addr-line>Naples</addr-line>, <country>Italy</country>
</aff>
<author-notes>
<fn fn-type="edited-by">
<p>
<bold>Edited by:</bold> <ext-link ext-link-type="uri" xlink:href="https://loop.frontiersin.org/people/286086/overview">Peter Nagy</ext-link>, University of Debrecen, Hungary</p>
</fn>
<fn fn-type="edited-by">
<p>
<bold>Reviewed by:</bold> <ext-link ext-link-type="uri" xlink:href="https://loop.frontiersin.org/people/2522661/overview">Narva Deshwar Kushwaha</ext-link>, Wayne State University, United States</p>
<p>
<ext-link ext-link-type="uri" xlink:href="https://loop.frontiersin.org/people/184010/overview">Arvind Ramanathan</ext-link>, Argonne National Laboratory (DOE), United States</p>
</fn>
<corresp id="c001">&#x2a;Correspondence: Carla Isernia, <email>carla.isernia@unicampania.it</email>; Gaetano Malgieri, <email>gaetano.malgieri@unicampania.it</email>
</corresp>
</author-notes>
<pub-date pub-type="epub">
<day>11</day>
<month>06</month>
<year>2025</year>
</pub-date>
<pub-date pub-type="collection">
<year>2025</year>
</pub-date>
<volume>13</volume>
<elocation-id>1597656</elocation-id>
<history>
<date date-type="received">
<day>21</day>
<month>03</month>
<year>2025</year>
</date>
<date date-type="accepted">
<day>30</day>
<month>05</month>
<year>2025</year>
</date>
</history>
<permissions>
<copyright-statement>Copyright &#xa9; 2025 Shitaye, Ventserova, D&#x2019;Abrosca, Dragone, Maina, Fattorusso, Iacovino, Russo, Isernia and Malgieri.</copyright-statement>
<copyright-year>2025</copyright-year>
<copyright-holder>Shitaye, Ventserova, D&#x2019;Abrosca, Dragone, Maina, Fattorusso, Iacovino, Russo, Isernia and Malgieri</copyright-holder>
<license xlink:href="http://creativecommons.org/licenses/by/4.0/">
<p>This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.</p>
</license>
</permissions>
<abstract>
<p>Virus survival inside the host cell depends on the intricate mechanisms that recruit proteins involved in the arms race. Severe Acute Respiratory Syndrome Coronavirus-2 (SARS-CoV-2) proteome exhibits important levels of structural order. However, some of the SARS-CoV-2 proteins, such as the Nucleocapsid (N) and Non-structural protein 1 (Nsp1), contain a considerably significant amount of intrinsically disordered regions (IDRs) that play indispensable roles in the intra-viral and virus-host interaction. Here, focusing on proteins that contain a relevant percentage of IDRs, we discuss experimental and computational studies sought to support IDRs as a key player in the interplay with ordered domains, the biological role as potential origin for variants of SARS-CoV-2, and their association with virus transmissibility. Furthermore, we also highlight the potential involvement of IDRs in the viral-host protein interaction and host cellular machinery. Thus, shading lights on the dark proteome of the virus and looking for therapeutic approaches beyond the classic structure-function paradigm may contribute to the efforts sparking the quest for therapeutics.</p>
</abstract>
<kwd-group>
<kwd>intrinsically disordered proteins</kwd>
<kwd>coronaviruses</kwd>
<kwd>SARS-COV-2 variants</kwd>
<kwd>protein-protein interactions</kwd>
<kwd>host-viral interactions</kwd>
</kwd-group>
<custom-meta-wrap>
<custom-meta>
<meta-name>section-at-acceptance</meta-name>
<meta-value>Chemical Biology</meta-value>
</custom-meta>
</custom-meta-wrap>
</article-meta>
</front>
<body>
<sec id="s1">
<title>1 Introduction</title>
<p>One of the central dogmas of molecular biology is the sequence-structure-function relationship: the primary sequence of amino acids determines the protein&#x2019;s three-dimensional structure that, in turn, defines its function. In the past couple of decades, such a relationship in the field of structural biology has been questioned by the fact that naturally occurring unstructured proteins that deviate from this dogma are increasingly identified. The so-called Intrinsically Disordered Proteins (IDPs), which do not have well-defined secondary, tertiary and, in specific cases, quaternary structures but still exhibit many important biological processes (<xref ref-type="bibr" rid="B42">Dyson and Wright, 2005</xref>; <xref ref-type="bibr" rid="B41">Dunker et al., 2001</xref>; <xref ref-type="bibr" rid="B86">Kulkarni et al., 2025</xref>), have become hot topics in the &#x201c;proteins world.&#x201d; Just like other functional molecules, disordered proteins play key roles in molecular and cellular events such as cellular signal transduction, cell cycle, transcriptional regulation, and translation (<xref ref-type="bibr" rid="B151">Tompa, 2002</xref>; <xref ref-type="bibr" rid="B68">Iakoucheva et al., 2002</xref>; <xref ref-type="bibr" rid="B109">Mishra et al., 2020</xref>). Moreover, a great number of proteins that are not commonly classified as IDPs encompass extensive segments characterized by an intrinsic disorder, often defined as intrinsically disordered regions (IDRs). These IDRs are widely distributed across the proteome of different organisms with significant variations within the entire protein in terms of composition and percentage content (<xref ref-type="bibr" rid="B41">Dunker et al., 2001</xref>; <xref ref-type="bibr" rid="B123">Peng et al., 2015</xref>).</p>
<p>Despite the fact that disordered regions act as mediators of cell signaling and other indispensable biological processes, generally, their essential role has a biological cost: IDRs, not protected by a structure, are more prone to involvement in mis-functional processes, i.e., aggregation above all.</p>
<p>Physico-chemical changes in the cellular environment can, in principle, affect their normal functions consequently leading to pathogenesis and diseases.</p>
<p>One of the hallmarks of many viruses is the effective utilization of their own IDPs/IDRs to perform essential cellular processes to escape from the host defense mechanism (<xref ref-type="bibr" rid="B37">Davey et al., 2011</xref>; <xref ref-type="bibr" rid="B43">Dyson and Wright, 2018</xref>). This outlines the importance of a thorough characterization of the role of IDRs to understand the molecular mechanism of diseases beyond the classic structure&#x2212;function paradigm.</p>
<p>Even though the characterization of IDPs and IDRs is a major challenge in biology, since the outbreak of Coronavirus disease 2019 (COVID-19) tremendous efforts have been made to unravel the structural biology of IDRs in the SARS-CoV-2 proteome. A plethora of computational and experimental spectroscopic techniques such as Nuclear Magnetic Resonance (NMR), Circular Dichroism (CD) and Small-angle scattering of X-rays (SAXS), have been used to study these dancing proteins. Beyond reviewing the common knowledge on IDPs and IDRs, the aim of this review is summarizing and analyzing the intrinsically disordered regions of the SARS-CoV-2 proteome, the information available on their biological role, their interaction with globular domains, their importance as source of mutations and viral transmissibility, and the potential involvement with the host cellular machineries. Firstly, we highlighted the percentage of the intrinsic disordered regions within different proteins across the SARS-CoV-2 proteome and opted to summarize the role of IDRs in Nucleocapsid and Non-structural protein 1. We then discuss the role or association of IDRs with SARS-CoV-2 infectivity and transmissibility along with experimentally and computationally explored molecular driving forces acting as local determinants of IDRs conformational changes. Finally, focusing on the SARS-CoV-2 proteins that contain significant disordered regions, we highlighted the potential involvement of their IDRs in the viral-host protein interactions and the effects on the host cellular machinery.</p>
</sec>
<sec id="s2">
<title>2 Overview of genome organization and IDR content of coronaviruses</title>
<p>Coronaviruses (CoVs) are a widely varied family of enveloped positive-sense single-stranded RNA viruses. By virtue of their ubiquitous presence in nature, they are broadly spread among mammals and avian species. CoVs belong to the <italic>Coronaviridaes</italic> family of the <italic>Nidovirales</italic> order and can be classified into four genera: alphacoronavirus, betacoronavirus, gammacoronavirus and deltacoronavirus.</p>
<p>Betacoronavirus (&#x3b2;-CoV), such as Severe Acute Respiratory Syndrome Coronaviruses (SARS-CoV-1 and SARS-CoV-2) and Middle Eastern Respiratory Syndrome virus (MERS-CoV), are highly pathogenic viruses for humans that share similar genome and replication strategies (<xref ref-type="bibr" rid="B45">Enjuanes et al., 2006</xref>; <xref ref-type="bibr" rid="B159">V&#x2019;kovski et al., 2021</xref>).</p>
<p>The SARS-CoV-2 genome, with an approximate length of 30 kb, encodes structural proteins, non-structural proteins (NSPs), and a number of accessory proteins. The four major structural proteins, namely, Spike (S), Nucleocapsid (N), Membrane (M), and Envelope (E) protein, are essential components required for the production of a structurally complete viral particle. Specific interactions between the viral S protein and host cell surface factors, serine protease TMPRSS2, and the receptor angiotensin-converting enzyme 2 (ACE2) promote viral uptake and cellular fusion. N protein is implicated in RNA encapsidation, while proteins E and M guarantee RNA genome (&#x2b;ssRNA) incorporation into viral particles during the assembly process.</p>
<p>Upon infection, the incoming viral RNA is uncoated inside the host cytosol and two large viral open reading frames, ORF1a and ORF1b, are translated into two polyproteins, pp1a and pp1ab, that are further cleaved into 11 and 15 Nsps, respectively. The 16 Nsps thus produced form the viral replication and transcription complex (<xref ref-type="fig" rid="F1">Figure 1</xref>) (<xref ref-type="bibr" rid="B159">V&#x2019;kovski et al., 2021</xref>; <xref ref-type="bibr" rid="B100">Masters, 2006</xref>; <xref ref-type="bibr" rid="B161">Wang et al., 2017</xref>; <xref ref-type="bibr" rid="B101">McBride et al., 2014</xref>; <xref ref-type="bibr" rid="B99">Malone et al., 2022</xref>).</p>
<fig id="F1" position="float">
<label>FIGURE 1</label>
<caption>
<p>
<bold>(A)</bold> Scheme of SARS-CoV-2 genome organization; SARS-CoV-2 contains 5&#x2032;capped mRNA that has a leader sequence (LS), poly-A tail at 3&#x2032;end, and 5&#x2032;and 3&#x2032;UTR. It contains genes such as ORF1a, ORF1b, Polyproteins (pp1a and pp1ab), S: Spike, ORF3a, ORF3b, E: Envelope, M: Membrane, ORF6, ORF7a, ORF7b, ORF8, ORF9b, ORF14, N: Nucleocapsid, and ORF10. <bold>(B)</bold> Overview of the IDRs across SARS-CoV-2 proteome. Heatmap indicates the mean PPID predicted by <xref ref-type="bibr" rid="B51">Giri et al. (2021)</xref> and experimental methods used to characterize SARS-CoV-2 proteins structure. The mean PPID of the all protein except Nsp11 is taken from <xref ref-type="bibr" rid="B51">Giri et al. (2021)</xref>, whereas the level of disorder for Nsp11 is described by <xref ref-type="bibr" rid="B50">Gadhave et al. (2021)</xref>. &#x2a;Giri et al. used the translated sequences of SARS-CoV-2 proteins [GenBank database <xref ref-type="bibr" rid="B30">Clark et al. (2016)</xref> (Accession ID: NC_045512.2)], and predicted IDPRs using a range of bioinformatics tools such as PONDR&#xae; (Predictor of Natural Disordered Regions) family including PONDR &#xae;VLS2 <xref ref-type="bibr" rid="B120">Peng et al. (2006)</xref>, PONDR &#xae;VL3 <xref ref-type="bibr" rid="B121">Peng et al. (2005)</xref>, PONDR &#xae;FIT <xref ref-type="bibr" rid="B170">Xue et al. (2010)</xref>, and PONDR &#xae;VLXT <xref ref-type="bibr" rid="B133">Romero et al. (2001)</xref>, as well as the IUPred platform for predicting long (&#x2265;30 residues) and short IDPRs (&#x3c;30 residues) <xref ref-type="bibr" rid="B104">M&#xe9;sz&#xe1;ros et al. (2018)</xref>. </p>
</caption>
<graphic xlink:href="fchem-13-1597656-g001.tif">
<alt-text content-type="machine-generated">D</alt-text>
</graphic>
</fig>
<p>Bioinformatics studies analyzed the percentage of intrinsic disorder (PID), quantified as the ratio between residues predicted to be disordered and the total number of residues, in the MERS-CoV proteome and in individual proteins derived from the MERS-CoV genome. Predicted percentage of intrinsic disorder (PPID) is a metric calculated as the ratio of disordered residues (those predicted to be disordered) to the total number of residues, expressed as a percentage, which is used to estimate the degree of intrinsic disorder within a protein (<xref ref-type="bibr" rid="B128">Rajagopalan et al., 2011</xref>; <xref ref-type="bibr" rid="B130">Redwan et al., 2019</xref>). Thus, the levels of PPID were applied to categorize proteins as highly ordered (PPID &#x3c;10%), moderately disordered (10% &#x2264; PPID &#x3c;30%), and highly disordered (PPID &#x2265;30%) (<xref ref-type="bibr" rid="B128">Rajagopalan et al., 2011</xref>; <xref ref-type="bibr" rid="B52">Giri et al., 2021</xref>). According to these examinations, N proteins are characterized by a higher value of PID (<xref ref-type="bibr" rid="B54">Goh et al., 2020</xref>; <xref ref-type="bibr" rid="B55">Goh et al., 2013</xref>; <xref ref-type="bibr" rid="B8">Alshehri et al., 2021</xref>).</p>
<p>In the scenario of SARS-CoV-2, a significant (refers to the percentage) level of disorder content was found for the S1 subunit of S protein and up to 51% for N protein. In these intrinsically disordered regions an abundance of mutations occurring in the 14 major variants were localized [<italic>Variants of Concern (VOC)]: Alpha, Beta, Gamma, Delta, Omicron BA.1 and BA.2; Variants of Interest (VOI) Lambda, Mu, Epsilon, Zeta, Eta, Theta, Iota and Kappa.)</italic> that could favor the virus with benefits for genetic and antigenic drift (<xref ref-type="bibr" rid="B9">Anjum et al., 2022</xref>; <xref ref-type="bibr" rid="B126">Quaglia et al., 2022</xref>). Another study buttresses that N protein possesses a predicted PID value of more than 60% and demonstrates moderate content of disorder for some of the nonstructural proteins and accessory proteins, namely, Nsp8, Nsp1, ORF6, ORF9b (<xref ref-type="bibr" rid="B52">Giri et al., 2021</xref>; <xref ref-type="bibr" rid="B9">Anjum et al., 2022</xref>; <xref ref-type="bibr" rid="B131">Rezaei et al., 2022</xref>). Interestingly, the nonstructural proteins, including Nsp2-Nsp6, Nsp9, Nsp10, and Nsp12-Nsp16 of SARS-CoV-2 proteins, show a quite less content of disordered regions (<xref ref-type="bibr" rid="B52">Giri et al., 2021</xref>; <xref ref-type="bibr" rid="B9">Anjum et al., 2022</xref>).</p>
<sec id="s2-1">
<title>2.1 The nucleocapsid protein</title>
<p>As previously discussed, within the SARS-CoV-2 proteome, the N protein stands out with a substantial amount of predicted disordered content. The SARS-CoV-2 N is a 419 amino acid protein that bears two ordered domains: the RNA-binding N terminal domain (NTD) (residues 48&#x2013;175), which contains the RNA recognition motif (RRM), and the C terminal domain (CTD) (248&#x2013;365) (<xref ref-type="bibr" rid="B77">Kang et al., 2020</xref>; <xref ref-type="bibr" rid="B71">Jayaram et al., 2006</xref>; <xref ref-type="bibr" rid="B58">Grossoehme et al., 2009</xref>; <xref ref-type="bibr" rid="B66">Huang et al., 2004</xref>), primarily associated with the formation of higher-ordered structures. The N protein also contains three intrinsically disordered regions: IDR1 (residues 1&#x2013;48), the central SR-IDR2 (residues 175&#x2013;248), which is enriched with serines and arginines and separates the two ordered domains, and the C-terminal IDR. Interestingly, the N in complex with its partner proteins Nsp3a exhibits dynamic nature (<xref ref-type="fig" rid="F2">Figure 2</xref>). For example, as clearly demonstrated from its solution NMR structure (PDB ID: 7PKU), the SR-IDR2 shows a tendency to form a helix (<sup>219</sup>LALLLLDRLNQL<sup>230</sup>) and disordered polar strand (<sup>243</sup>GQTVTKKSAAEAS<sup>255</sup>) (<xref ref-type="bibr" rid="B12">Bessa et al., 2022</xref>). N shows structural plasticity and its predicted structure could sample modest helical conformation based on the sequence <sup>390</sup> QTVTLLPAADLDDFSKQLQQSMSSADSTQA<sup>419</sup> (IDR3 region) (<xref ref-type="bibr" rid="B182">Zhao et al., 2022</xref>).</p>
<fig id="F2" position="float">
<label>FIGURE 2</label>
<caption>
<p>Scheme of the overall structure of the SARS-CoV-2 N protein. N protein consists of the N-terminal arm (IDR1), the RNA-binding N-terminal domain (NTD), the central linker region (LKR) within a Ser/Arg (SR)&#x2013;rich motif, the C-terminal domain (CTD), associated with dimerization, and the C-terminal tail (C-tail). The up-left panel illustrates the surface of the amino-terminal (N-terminal) domain (PDB ID: 6M3M) <xref ref-type="bibr" rid="B77">Kang et al. (2020)</xref>. The up-right panel illustrates the surface representation of the dimeric carboxy-terminal (C-terminal) domain (PDB ID: 6YUN)) (each monomer presented by separate color code). <xref ref-type="bibr" rid="B185">Zinzula et al. (2021)</xref>. The lower panel represents AlphaFold 3 prediction of full-length N protein encompassing folded domain (surface representation) and IDRs <xref ref-type="bibr" rid="B2">Abramson et al. (2024)</xref>.</p>
</caption>
<graphic xlink:href="fchem-13-1597656-g002.tif">
<alt-text content-type="machine-generated">D</alt-text>
</graphic>
</fig>
<p>A great number of studies have shown that several N proteins bind to multiple RNA molecules without exhibiting binding specificity to RNA sequences (<xref ref-type="bibr" rid="B23">Carlson et al., 2020</xref>; <xref ref-type="bibr" rid="B70">Iserm et al., 2020</xref>; <xref ref-type="bibr" rid="B124">Perdikari et al., 2020</xref>; <xref ref-type="bibr" rid="B136">Savastano et al., 2020</xref>). It is assumed that a single molecule of genomic RNA is enveloped by multiple N proteins and packaged into virions (<xref ref-type="bibr" rid="B173">Yao et al., 2020</xref>; <xref ref-type="bibr" rid="B33">Cubuk et al., 2021</xref>; <xref ref-type="bibr" rid="B81">Klein et al., 2020</xref>).</p>
<p>
<italic>In vivo</italic> studies showed that the recognition of RNA that has to be packed requires both the NTD and CTD domains of N protein (<xref ref-type="bibr" rid="B167">Woo et al., 2019</xref>); specifically, the N-terminal linker region and C-terminal segments are required for RNA recognition and binding. (<xref ref-type="bibr" rid="B71">Jayaram et al., 2006</xref>; <xref ref-type="bibr" rid="B58">Grossoehme et al., 2009</xref>; <xref ref-type="bibr" rid="B34">Cui et al., 2015</xref>; <xref ref-type="bibr" rid="B177">Yu et al., 2005</xref>; <xref ref-type="bibr" rid="B116">Nelson and Stohlman, 1993</xref>) (<xref ref-type="bibr" rid="B33">Cubuk et al., 2021</xref>; <xref ref-type="bibr" rid="B25">Chang et al., 2009</xref>; <xref ref-type="bibr" rid="B168">Wu et al., 2021</xref>). By means of charge distribution analysis of dimeric CTDs, Jia et al. identified in their surface a stretch of positively charged residues (between Lys257 and Arg262) involved in RNA-binding (<xref ref-type="bibr" rid="B72">Jia et al., 2022</xref>) and conserved among SARS-CoV-1, SARS-CoV-2, and MERS-CoV (<xref ref-type="fig" rid="F3">Figure 3</xref>).</p>
<fig id="F3" position="float">
<label>FIGURE 3</label>
<caption>
<p>Schematic representation of the structure of the SARS-CoV-2 N protein; N-terminal domain (NTD), C-terminal domain (CTD), IDR1 (light blue color), SR-IDR2 (orange color), IDR3 (dark blue color) and the stretch of positively charged residues: Lys257- Arg262 (underlined, illustrated in blue color with side-chain visualization on the protein structure). The 3D structure shows the prediction by AlphaFold 3 based on the sequence (accession no: P0DTC9.1) <xref ref-type="bibr" rid="B2">Abramson et al. (2024)</xref>.</p>
</caption>
<graphic xlink:href="fchem-13-1597656-g003.tif">
<alt-text content-type="machine-generated">D</alt-text>
</graphic>
</fig>
<p>Mutations of these conserved positive residues can significantly decrease the binding affinity with RNA, confirming their role in RNA binding (<xref ref-type="bibr" rid="B27">Chen et al., 2007</xref>; <xref ref-type="bibr" rid="B64">Hsin et al., 2018</xref>; <xref ref-type="bibr" rid="B172">Yang et al., 2021</xref>). Upon binding to the RNA, the SARS-CoV-2 N protein undergoes a more compact conformation compared to its free form (<xref ref-type="bibr" rid="B132">Ribeiro-Filho et al., 2022</xref>). Interestingly, the stability of the small N protein structure seems to be dependent on the N-terminal RNA-binding domain (<xref ref-type="bibr" rid="B139">Sekine et al., 2023</xref>). Inhibiting the RNA binding specificity of N proteins in betacoronaviruses with antiviral drugs could combat a range of these viruses, aiding in future outbreaks.</p>
</sec>
<sec id="s2-2">
<title>2.2 Non-structural protein 1 (Nsp1)</title>
<p>Several research delves into the characterization of the full-length SARS-CoV-2 Nsp1 (1&#x2013;180) (<xref ref-type="fig" rid="F4">Figure 4</xref>), which plays a dual role through initiating viral protein synthesis and inhibiting host translation; it engages with the host 40S ribosomal subunit, thereby prevents initiation of host protein translation. Crystal structures of Nsp1 proteins of SARS-CoV (aa 10&#x2013;126) (<xref ref-type="bibr" rid="B6">Almeida et al., 2007</xref>) and SARS-CoV-2 (aa 12&#x2013;127) (<xref ref-type="bibr" rid="B31">Clark et al., 2021</xref>; <xref ref-type="bibr" rid="B140">Semper et al., 2021</xref>) show nearly the same folded N-terminal domain architecture. Interestingly, most of the residues predicted to be disordered are localized in the C-terminal tail (125&#x2013;179) that directly binds within the mRNA entry tunnel of the 40S (<xref ref-type="bibr" rid="B4">Agback et al., 2021</xref>; <xref ref-type="bibr" rid="B69">Ilyas et al., 2025</xref>).</p>
<fig id="F4" position="float">
<label>FIGURE 4</label>
<caption>
<p>Scheme of the overall structure of the SARS-CoV-2 Nsp1 and its disordered predicted regions. Left panel shows the schematic representation of domain organization and amino acid sequence of Nsp1. Up-right panel shows experimental structure of Nsp1 that consists of IDR1 (light blue color), the N-terminal domain (NTD), LKR (Linker) (green color), and the IDR2-CTD (orange color) (the last two usually reported under the denomination C-terminal tail) (PDB ID:8AOU). <xref ref-type="bibr" rid="B163">Wang et al. (2023)</xref> Right-down panel represents the AlphaFold 3 model of Nsp1 structure <xref ref-type="bibr" rid="B163">Abramson et al. (2024)</xref>.</p>
</caption>
<graphic xlink:href="fchem-13-1597656-g004.tif">
<alt-text content-type="machine-generated">D</alt-text>
</graphic>
</fig>
<p>2D <sup>15</sup>N-{<sup>1</sup>H} NOE NMR experiment on full-length SARS-CoV Nsp1 protein revealed that its residues 1 to 12 and 129 to 179 have small positive or negative <sup>15</sup>N,<sup>1</sup>H heteronuclear NOE values, characterizing these regions as short N-terminal and long C-terminal disordered tails (<xref ref-type="bibr" rid="B6">Almeida et al., 2007</xref>) with a remarkable conformational flexibility at sub-nanoseconds timescale. Using cryogenic electron microscopy, different groups of researchers were able to solve the structure of the C-terminal portion of SARS-CoV-2 Nsp1 in complex with the 40S ribosome (<xref ref-type="bibr" rid="B148">Thoms et al., 2020</xref>; <xref ref-type="bibr" rid="B138">Schubert et al., 2020</xref>). These structures confirm the presence of a short &#x3b1;-helix (P153 to N160) and a second&#xa0;C-terminal &#x3b1;-helix spanning residues S166 to N178. Likewise, the study by Semper et al. combines SARS-CoV-2 Nsp1 (13&#x2013;127) crystal structure (PDB ID:7K3N) with amino acid sequence analysis, data from prediction tools, and homology-based models, showing the presence of 12 N-terminal residues comprising disordered regions as well as a largely disordered linker between the end of the globular domain and the C-terminal helix-turn-helix (<xref ref-type="bibr" rid="B140">Semper et al., 2021</xref>).</p>
<p>Furthermore, a C-terminal helix-turn-helix motif is proposed in their homology-based model of full-length Nsp1 (<xref ref-type="bibr" rid="B140">Semper et al., 2021</xref>). While the study of Kumar and coworkers (<xref ref-type="bibr" rid="B87">Kumar et al., 2021</xref>), in line with previous studies, validated the C-terminal IDR region (131&#x2013;180) in isolation, Thoms et al. have shown that after interaction with the 40S ribosome, such region adopts a helical structure (<xref ref-type="bibr" rid="B148">Thoms et al., 2020</xref>) suggesting its important role in regulating host mRNA translation.</p>
<p>Secondary structure analysis of the full-length SARS-CoV-2 Nsp1 protein by means of NMR (<xref ref-type="bibr" rid="B4">Agback et al., 2021</xref>; <xref ref-type="bibr" rid="B164">Wang Y. et al., 2021</xref>) revealed one folded domain that comprises residues T14&#x2013;L125 and two disordered chains at the N-terminus (residues 1&#x2013;13) and at the C-terminus (residues 126&#x2013;180), respectively. As clearly demonstrated by Agback and coworkers (<xref ref-type="bibr" rid="B4">Agback et al., 2021</xref>), SARS-CoV-2 Nsp1 in solution shows different dynamics of N- and C-termini. They were also able to demonstrate that residues located between the folded domain and the disordered C-terminal exhibit different conformations. For example, the region at the beginning of the C-terminal domain (<sup>122</sup>LLRK<sup>125</sup>) has been shown to adopt two different conformations distinguishable on the NMR time scale even at high temperature (308K) (<xref ref-type="bibr" rid="B4">Agback et al., 2021</xref>).</p>
</sec>
</sec>
<sec id="s3">
<title>3 Globular domain&#x2013;IDRs interplay</title>
<p>Along with interplay between the structured part and the IDRs within each specific protein, the vast majority of disordered regions in the SARS-CoV-2 are also involved in protein-protein interactions with other viral and host proteins. Protein-protein interaction (PPI) is a key biological process, established often in a specific and stable manner by a physical contact of two or more proteins in cells which form a complicated network termed &#x201c;interactome&#x201d; (<xref ref-type="bibr" rid="B82">Koh et al., 2012</xref>; <xref ref-type="bibr" rid="B157">Venkatesan et al., 2009</xref>).</p>
<p>Due to the dynamic nature of proteins, the environment in which they exist largely influences their motion, and it must be taken into proper consideration while discussing protein-protein interactions (PPI) (<xref ref-type="fig" rid="F5">Figure 5</xref>).</p>
<fig id="F5" position="float">
<label>FIGURE 5</label>
<caption>
<p>Schematic overview in PPIs (Left panel) Ordered-ordered interaction describes a scenario where two systems possessing well-defined, structured arrangements, engage with each other while maintaining their respective order. (Middle panel) Ordered-disordered interactions refer to the binding of an IDP to a folded protein; the IDP can either stay unfolded in the bound states and adopt multiple conformations or fold upon binding. In the case of coupled unfolding, though the folded binding partner remains structured, it can partially unfold. (Right panel) Interactions between two IDPs through regions that are inherently flexible or disordered can result in &#x201c;Fuzzy complexes&#x201d; which exhibit heterogeneous structure without a fixed binding interface Adapted from <xref ref-type="bibr" rid="B143">Spreitzer et al. (2020)</xref>.</p>
</caption>
<graphic xlink:href="fchem-13-1597656-g005.tif">
<alt-text content-type="machine-generated">D</alt-text>
</graphic>
</fig>
<p>IDPs are prone to posttranslational modifications (<xref ref-type="bibr" rid="B35">Darling and Uversky, 2018</xref>; <xref ref-type="bibr" rid="B73">Jin and Gr&#xe4;ter, 2021</xref>; <xref ref-type="bibr" rid="B118">Niklas et al., 2015</xref>) and, therefore, are likely to exist as chemically heterogeneous intracellular populations. Compared to the structured proteins, IDPs are more susceptible to environmental changes that can determine the IDR/IDP structure and function. The term &#x201c;environment&#x201d; intends a broad context: physicochemical environment (pH, viscosity, pressure, salt concentration, <italic>etc.</italic>) (<xref ref-type="bibr" rid="B94">Lindsay et al., 2021</xref>; <xref ref-type="bibr" rid="B158">Verma et al., 2020</xref>), biomolecular environment, (interactors and location), physiological environment (cell-type, cell-cycle, stress, <italic>etc.</italic>) (<xref ref-type="bibr" rid="B158">Verma et al., 2020</xref>), and intramolecular interactions (<xref ref-type="bibr" rid="B19">Bugge et al., 2021</xref>; <xref ref-type="bibr" rid="B18">Bugge et al., 2020</xref>).</p>
<p>As well documented from physicochemical (<xref ref-type="bibr" rid="B93">Lin et al., 2018</xref>) and quantitative studies (<xref ref-type="bibr" rid="B17">Bowman et al., 2020</xref>), amino acid sequence encodes IDRs conformational behavior as well as their interaction and function (<xref ref-type="bibr" rid="B36">Das et al., 2015</xref>; <xref ref-type="bibr" rid="B29">Chong and Mir, 2021</xref>). Collectively, many studies evidence that polypeptides and proteins that carry high net charges are known to undergo extended conformations. Charged residues in intrinsically disordered proteins also drive the interaction with biomolecules (<xref ref-type="bibr" rid="B17">Bowman et al., 2020</xref>; <xref ref-type="bibr" rid="B106">Milorey et al., 2021</xref>).</p>
<p>Transient interactions are another attribute that characterize disordered proteins. Multiple interactions contribute to their dynamic behavior and to possible structural transitions. In many cases, hydrophobic interactions primarily play a role in the disorder-structure paradigm of the IDR systems. Abyzov et al. showed liquid&#x2212;liquid phase separation (LLPS) derived as a result of intermolecular interactions. The interaction was observed to be responsible for modulating internal motions, slowing down the time scales of IDP motions, and restricting the amplitude of the local backbone conformational sampling (<xref ref-type="bibr" rid="B3">Abyzov et al., 2022</xref>). In their analysis, the authors noted that the locally accessible surface determines the interaction between IDP tails and the folded domains that in turn act as local determinants of IDR conformational behavior. In their study, Taneja and Holehouse exploited this behavior to investigate the role of the relative position and accessibility of charged residues across the surface of a folded domain. Simulations on homologs protein with variable charge distribution demonstrated that even slight changes in surface charge impact IDR behavior and interaction with folded domains (<xref ref-type="bibr" rid="B146">Taneja and Holehouse, 2021</xref>). Of note, due to the presence of multiple charge patches on naturally occurring proteins and their physical accessibility to local IDRs, these changes in the chemical environment are highly relevant to modulate the interaction (<xref ref-type="bibr" rid="B166">Wohl et al., 2025</xref>).</p>
<p>Mukherjee et al. used conformation-sensitive single-molecule F&#xf6;rster resonance energy transfer and CD to understand the effects of cellular components on the conformation of the SARS-CoV-2 RG-1 RNA G4Q. The authors confirmed that salts, co-solutes, crowders, and other IDPs affect the conformation of the SARS-CoV-2 RG-1 RNA G4Q. For instance, in the absence of monovalent K<sup>&#x2b;</sup> salt, the RG-1 SARS-CoV-2 RNA-G4Q exists as an equilibrium between folded and metastable conformation, whereas at a high concentration of K<sup>&#x2b;</sup>, only the fully folded conformations are preserved. Recent reports of Parkinson&#x2019;s disease cases involving young patients after SARS-CoV-2 infections showed that amyloidogenic disordered &#x3b1;-Syn-derived peptides stabilized the folded state of RG-1 G4Q, although human islet amyloid polypeptide (hIAPP) stabilized the partially folded state, leading to the conclusion that these interactions may afflict expression profiles of disease-modifying genes (<xref ref-type="bibr" rid="B114">Mukherjee et al., 2022</xref>). Yesudhas et al. used molecular dynamics simulations to investigate the binding contributions of intrinsically disordered residues of S protein to human ACE2 proteins. They observed a disorder-to-order transition (DOT) profile upon binding that is strengthened mainly by the hydrophilic and aromatic residues localized in the region that undergoes such disorder-to-order transition. The authors hypothesized that this more energetically favorable binding of receptor binding domains with ACE2 is due to the positively correlated motion of the DOTs with its neighboring residues (<xref ref-type="bibr" rid="B176">Yesudhas et al., 2021</xref>; <xref ref-type="bibr" rid="B5">Akbayrak et al., 2022</xref>). Moreover, the conformational disorder of the N- and C-terminal residues and water accessibility of the SARS-CoV-2 envelop protein increased in acidic pH and high calcium ions concentration (<xref ref-type="bibr" rid="B102">Medeiros-Silva et al., 2022</xref>).</p>
<sec id="s3-1">
<title>3.1 Nucleocapsid</title>
<p>While considerable emphasis has been placed on the S protein, numerous other proteins of SARS-CoV-2, such as N protein, also hold pivotal significance in viral physiology. However, our understanding of their structural and biophysical characteristics remains comparatively limited. N is an abundant RNA-binding protein involved in packaging and transcription facilitation. It is also one of the mutational hotspots in the SARS-CoV-2 genome.</p>
<p>As reported in <xref ref-type="sec" rid="s2-1">Section 2.1</xref>, the SARS-CoV-2 N comprises three predicted intrinsically disordered regions, an N-arm (IDR1), a C-tail (IDR3), and a centrally located linker region (SR-IDR2) that connects the NTD and CTD. In their elegant work, Cubuk and co-authors using single-molecule fluorescence spectroscopy with all-atom simulations proved the structural heterogeneity of these three IDR domains (<xref ref-type="bibr" rid="B33">Cubuk et al., 2021</xref>).</p>
<p>In betacoronaviruses, the IDR site (the N protein primary phosphorylation site) that acts as a linker between the NTD and CTDdomains has arginine/serine rich region and can undergo phosphorylation, that in turn affects the protein function (<xref ref-type="bibr" rid="B23">Carlson et al., 2020</xref>; <xref ref-type="bibr" rid="B122">Peng et al., 2008</xref>; <xref ref-type="bibr" rid="B96">Lu et al., 2021</xref>). By means of nanosecond fluorescence correlation spectroscopy (FCS), a slower reconfiguration time (&#x3c4;<sub>r</sub> &#x3d; 170 &#xb1; 30&#x2009;ns.) in comparison with other proteins with similar length and charge content was revealed, suggesting that the NTD transiently interacts with the RNA-binding domain. This linker limits the interaction between the NTD and CTD domains but enables them to have an independent function (<xref ref-type="bibr" rid="B33">Cubuk et al., 2021</xref>), which probably prevents the formation of NTD dimers. The unstructured central linker can critically affect the N proteins binding conformation to RNA and to other proteins. The concurrent binding of IDR linker to both the CTD and NTD through intra and inter molecular interactions, (<xref ref-type="bibr" rid="B134">R&#xf3;&#x17c;ycki and Boura, 2022</xref>), the direct interaction of this linker to RNA <italic>via</italic> electrostatic interaction, and even the phosphorylation process (<xref ref-type="bibr" rid="B23">Carlson et al., 2020</xref>; <xref ref-type="bibr" rid="B122">Peng et al., 2008</xref>), can cause conformational changes in N protein.</p>
<p>Biomolecular condensates, essential for various cellular processes, can arise from the LLPS containing IDRs and RNA-binding domains. Then, a few studies have shown that, at the body temperature, the S/R-rich central disordered region significantly associates with the RNA-dependent phase separation of N protein where its phosphorylation regulates the condensate viscosity of cells (<xref ref-type="bibr" rid="B70">Iserm et al., 2020</xref>; <xref ref-type="bibr" rid="B96">Lu et al., 2021</xref>). Additionally, the recent study on the binding and compaction of SARS-CoV-2 full-length N protein and its truncated variants containing the globular domains with and without the linker region (<xref ref-type="bibr" rid="B113">Morse et al., 2023</xref>) confirms the pivotal role of the intrinsically disordered regions in maintaining the biological function of N protein. In detail, Morse et al. demonstrate that the N protein region IDR1-NTD-IDR2 missing the CTD and the disordered C-tail shows similar performance to compact the ssDNA as the full-length N protein, whilst the same portion without the IDR2 linker shows a dramatic lower activity. These binding differences to the ssDNA are due to the richness in serines and arginines of the IDR2 region that enables the preservation of the fast on/off kinetics and non-cooperative binding. It is also postulated that IDR2 may provide structural plasticity to the N protein (<xref ref-type="bibr" rid="B182">Zhao et al., 2022</xref>).</p>
<p>Experimental studies have quantified the affinity of N protein for RNA. For instance, Wu and his colleagues investigated contribution from each N protein domain to ssRNA binding (<xref ref-type="bibr" rid="B168">Wu et al., 2021</xref>). They found that N wild type binds the 20-nt ssRNA (sequence: UUU&#x200b;CAC&#x200b;CUC&#x200b;CCU&#x200b;UUC&#x200b;AGU&#x200b;UU) with high affinity (<italic>K</italic>
<sub>
<italic>D</italic>
</sub> &#x3d; 0.007 &#xb1; 0.001&#xa0;&#x3bc;M). In contrast, the isolated N<sub>NTD</sub> and N<sub>CTD</sub> have low-affinity binding (<italic>K</italic>
<sub>
<italic>D</italic>
</sub> &#x3d; 20 &#xb1; 10 and 13 &#xb1; 5&#xa0;&#x3bc;M, respectively). However, inclusion of the LKR region increased RNA binding affinity significantly (0.50 &#xb1; 0.08 and 0.35 &#xb1; 0.04&#xa0;&#x3bc;M for N<sub>NTD-LKR</sub> and N<sub>LKR-CTD</sub>, respectively). Addition of CTD onto NTD-LKR in cis increases the binding affinity to the single-digit nM range (0.006 &#xb1; 0.002&#xa0;&#x3bc;M), but not in trans. Overall this data quantitatively indicates that the wild-type N protein has high-affinity ssRNA binding, and unstructured regions contribute into ssRNA interactions.</p>
<p>The capacity of N protein to undergo LLPS is well-documented, defining starting N protein concentrations equals to 10&#xa0;&#xb5;M. However, the droplet sizes did not grow with increased concentration, even at a protein concentration of 40&#x2009;&#x3bc;&#x39c;. Interestingly, size of condensates was modulated by increasing RNAs concentration (at 1:0.25 protein: RNA ratio, the size and the sphericity of the droplets further increased. Since RNA is involved in the assembly of the viral to form a helical ribonucleoprotein (nucleocapsid), these condensates are proposed to enhance the efficiency of viral replication. Thus, these condensates could become a potential therapeutic target in order to disrupt cycles of SARS-CoV-2 replication (<xref ref-type="bibr" rid="B162">Wang J. et al., 2021</xref>).</p>
<p>Moreover, Morse et al. (<xref ref-type="bibr" rid="B113">Morse et al., 2023</xref>) suggest a description of a multistep process through which N proteins can bind and package viral RNA (vRNA). In particular, the N protein, which is abundantly expressed in the host cell, forms CTD-mediated dimers and quickly binds vRNA through NTDs and linkers, due to electrostatic interaction. This binding is non-cooperative and fully reversible. Over time, the binding increases resulting in substrate compaction as neighboring proteins multimerize. This assembly mechanism is modulated by the C-terminal domain, which can fully compact the substrate. Note that the ssDNA-protein complex compaction observed in this study is less extensive with respect to vRNA-N protein compaction inside the viral particle.</p>
<p>As reported above, the N-terminal and C-terminal IDRs contribute to the RNA-binding activity of the SARS-CoV-2 N protein. Using a biosafety level-2 cell culture system (<xref ref-type="bibr" rid="B75">Ju et al., 2021</xref>), Luo et al. found that deletion of IDR1 completely abolished SARS-CoV-2 production (<xref ref-type="bibr" rid="B98">Luo et al., 2021</xref>). Similarly, truncations of IDR1 weaken the RNA binding, as demonstrated by a chromatography study of the nucleoprotein both in RNA-bound states and RNA-free state (<xref ref-type="bibr" rid="B168">Wu et al., 2021</xref>), further suggesting the relevant biological role of IDRs cooperation with the folded domains.</p>
<p>Though both the NTD and CTD can bind RNA, practically no direct cooperation is observed between the two domains in RNA binding (<xref ref-type="bibr" rid="B85">Kubinski et al., 2025</xref>). Experimental data from combined coarse-grained molecular simulations with data from small-angle X-ray scattering (SAXS) on full-length SARS-CoV-2 N protein evidenced this scenario (<xref ref-type="bibr" rid="B134">R&#xf3;&#x17c;ycki and Boura, 2022</xref>). From the simulations, several intra- and inter-chain contacts between the formed hydrophobic &#x3b1;-helix within the IDR2 and the two ordered domains have been observed. This &#x3b1;-helix of IDR2 showed the most frequent degree of contact with the NTD of the same chain than the NTD of the other chain in the N dimer (<xref ref-type="bibr" rid="B134">R&#xf3;&#x17c;ycki and Boura, 2022</xref>).</p>
<p>IDR1 in SARS-CoV-2 N protein has been also found to be an indispensable mediator for the interaction between N protein and Ras-GTPase-activating protein SH3-domain binding (G3BP1), where the interaction leads to stress granule (SG) disassembly (<xref ref-type="bibr" rid="B96">Luo et al., 2021</xref>). As confirmed by the mutant, the N protein lacking IDR1 impaired its capability to colocalize with G3BP1 whereas deletion of the C-terminus containing homodimerization domain and IDR3 can facilitate the N protein diffusion within droplets. IDR1 initiates the LLPS of the N protein, whereas the C-terminal region stabilizes the condensate, likely by facilitating protein homodimerization. Meanwhile, SARS-CoV-2 N supposedly interacts with G3BP stress granule assembly factor 2, thereby consequently suppressing the integrated stress response and inhibiting type I interferon responses (<xref ref-type="bibr" rid="B84">Kruse et al., 2021</xref>; <xref ref-type="bibr" rid="B67">Huang et al., 2021</xref>; <xref ref-type="bibr" rid="B15">Biswal et al., 2022</xref>). The N-terminal intrinsically disordered tail is believed responsible for recruiting N protein into stress granules (<xref ref-type="bibr" rid="B26">Chang et al., 2014</xref>).</p>
<p>In the context of SARS-CoV-2 infection, Enoxaparin (EP) (a negatively charged, low molecular weight heparin) acted as an anticoagulant medication. The 2D CON NMR experiments in the presence of EP showed considerable chemical shift perturbation within the arginine-rich region of IDR1 <sup>37</sup>SKQRRPQ<sup>43</sup> and influenced the resonances in the IDR2 segment mainly composed of leucine residues <sup>217</sup>AALALLLL<sup>224</sup>, by promoting this region to sample a helical conformation. Such changes do not describe this scenario as a direct interaction with a negative &#x201c;ligand&#x201d; but lead to the conclusion that interaction with EP disrupts intramolecular interactions, as also observed upon RNA binding (<xref ref-type="bibr" rid="B137">Schiavina et al., 2022</xref>).</p>
<p>Replication-transcription complex (RTCs) is one of the vital machinery that enables the virus to recruit proteins. In betacoronaviruses, N is the major cofactor of this complex that interacts with the amino-terminal ubiquitin-like domain of Nsp3 (Ubl1). The study of Bessa et al. revealed a bipartite interaction between Ubl1 and two motifs in the IDR2 linker of N a hydrophobic helix (<sup>219</sup>LALLLLDRLNQL<sup>230</sup>) and a disordered polar strand (<sup>243</sup>GQTVTKKSAAEAS<sup>255</sup>). These interactions induce the folding of portions ofIDR2 around Ubl1, that in turn brings conformational changes in N protein and regulates its RNA binding (<xref ref-type="bibr" rid="B12">Bessa et al., 2022</xref>). Thus, the intrinsically disorder regions are hypothesized to be important players in complex mechanisms that underlie the regulation of ribonucleoprotein complex formation.</p>
<p>Serine and arginine residues are highly disorder-promoting residues (<xref ref-type="bibr" rid="B22">Campen et al., 2008</xref>), and are the most abundant in the flexible intrinsic disordered linker region of all types of coronaviruses (<xref ref-type="bibr" rid="B11">Barik, 2020</xref>). Coronavirus N protein phosphorylation is a pivotal process for the viral life cycle that predominantly occurs within distinct regions of intrinsically disordered proteins. Primarily, N protein phosphorylation is processed within the SR rich intrinsically disordered region, both in host cells and virions (<xref ref-type="bibr" rid="B28">Chen et al., 2005</xref>; <xref ref-type="bibr" rid="B165">White et al., 2007</xref>). However, the mechanisms and potential function of multiple SR rich motifs are still inadequately comprehended (<xref ref-type="bibr" rid="B174">Yaron et al., 2022</xref>; <xref ref-type="bibr" rid="B16">Bouhaddou et al., 2020</xref>; <xref ref-type="bibr" rid="B38">Davidson et al., 2020</xref>). N protein interacts with many viral proteins, nucleic acid, and the host protein factors through specific and nonspecific mechanisms of interaction. Such interaction may be facilitated, at least in part, by the phosphorylation process occurring mainly in the rich SR amino acid region of the IDRs.</p>
<p>It has been reported that phosphorylated N-protein strongly affects the RNA binding specificity (<xref ref-type="bibr" rid="B168">Wu et al., 2021</xref>) and nucleocytoplasmic shuttling of the N proteins (<xref ref-type="bibr" rid="B10">Bai et al., 2021</xref>). Hyper-phosphorylation of N protein also plays a role in promoting the interaction between replication-transcription complex and viral replicase subunit Nsp3 (<xref ref-type="bibr" rid="B79">Keane and Giedroc, 2013</xref>). Notably, phosphorylation offers a mechanism for the N protein to recruit host factors like RNA helicases that promote viral RNA template switching and subgenomic mRNA transcription (<xref ref-type="bibr" rid="B169">Wu et al., 2014</xref>). The N protein is presumably engaged to host mRNA and G3BP1, thus playing a role in suppressing the host innate immune response. Additionally, even though the underlying mechanisms are not clearly known, the phosphorylation of the central disordered region promotes the protein transcriptional function (<xref ref-type="bibr" rid="B23">Carlson et al., 2020</xref>). Indeed, the indispensable role of intrinsically disordered regions in the phosphorylation processes is worth mentioning and more should be explored on their regulatory roles and the phosphorylation itself in modulating and expanding the repertoire of biological activities of N protein in SARS-CoV-2.</p>
<p>Therefore, taken together all the above highlighted hallmarks make IDRs of the N protein a pivotal avenue for SARS-CoV-2 therapeutic advancement.</p>
</sec>
<sec id="s3-2">
<title>3.2 Non-structural protein 1</title>
<p>The biological function and mechanism of activity of regulation of Nsp1 seems dependent on the interplay between the N-terminal folded domain and the unstructured C-terminal domain, which comprises IDRs that bind to the host ribosome.</p>
<p>The role of the N-terminal domain in translation inhibition of Nsp1 and the binding of SARS-CoV-2 Nsp1 to the stem-loop structure of RNA 5&#x2032;-untranslated region (SL1) without the ribosome are two important topics. These SL structures are components of RNA 5&#x2032;-untranslated region (5&#x2032;UTR) that plays a role in regulation of gene expression, translation initiation, RNA folding, and stability. The SL1 region of the SARS-CoV-2 5&#x2032;UTR is a highly conserved sequence necessary to evade Nsp1-mediated translational suppression (<xref ref-type="bibr" rid="B160">Vora et al., 2022</xref>; <xref ref-type="bibr" rid="B88">Lan et al., 2022</xref>).</p>
<p>From solution NMR studies of SARS-CoV-2 Nsp1 (<xref ref-type="bibr" rid="B4">Agback et al., 2021</xref>), Agback et al. proposed intramolecular interactions between the disordered and folded Nsp1 domains. In fact, the Nsp1 H81P mutant shows chemical shifts perturbations within those parts of the protein that link structured/unstructured regions (amino acids 10-17 and 120-127). Similarly, other groups of researchers also suggested possible interactions between the disordered and folded Nsp1 domains (<xref ref-type="fig" rid="F6">Figures 6A&#x2013;E</xref>) (<xref ref-type="bibr" rid="B164">Wang Y. et al., 2021</xref>). These findings suggest that these domains are not fully independent units. Indeed, the folded NTD and the C-terminal intrinsically disordered region interact and their interaction is essential for the regulatory mechanism governing the activity of SARS-CoV-2 Nsp1. Molecular dynamics and simulation studies reported for SARS-CoV-2 the possible binding between SL1 and both the N-terminal globular and the C-terminal intrinsically disordered region of Nsp1 (<xref ref-type="bibr" rid="B154">Vankadari et al., 2020</xref>; <xref ref-type="bibr" rid="B135">Sakuraba et al., 2022</xref>): several interactions were observed between Nsp1 (residues including T12, Y118, R124, K125, N128, K129, L141, and D147) and SL1. In order to validate these findings, the residues K47, K58, R124/K125 were replaced with Alanine. Nsp1-wt, K47A, and K58A mutants were co-immunoprecipitated with the luciferase RNAs containing the 5&#x2032;UTR. Interestingly, co-immunoprecipitation of R124A/K125A with the luciferase RNAs containing the 5&#x2032;UTR was not detected, suggesting the crucial role of Nsp1 residues R124, K125 for viral RNA recognition (<xref ref-type="bibr" rid="B145">Tanaka et al., 2012</xref>; <xref ref-type="bibr" rid="B147">Terada et al., 2017</xref>; <xref ref-type="bibr" rid="B103">Mendez et al., 2021</xref>). From previous observations, it was assumed that the C-terminal domain of SARS-CoV-2 Nsp1 is necessary and sufficient to shut off host gene expression (<xref ref-type="bibr" rid="B138">Schubert et al., 2020</xref>). Later on, other studies based on <italic>in vitro</italic> and <italic>in cell</italic> experiments, further underlined that the coordinated mechanism of action including the N-terminal and central domains of Nsp1 are essential for host translation inhibition (<xref ref-type="bibr" rid="B103">Mendez et al., 2021</xref>; <xref ref-type="bibr" rid="B163">Wang et al., 2023</xref>). This could further strength the hypothesis on the molecular interplay among the folded domains and disordered regions.</p>
<fig id="F6" position="float">
<label>FIGURE 6</label>
<caption>
<p>The interaction of the flexible C-terminal tail with the NTD of SARS-CoV-2 Nsp1. <bold>(A)</bold> SARS-CoV-2 Nsp1 mapping of residues that undergo NMR long range NOE contacts. <bold>(B,D)</bold> reports the residues L122 and L4 (orange) and V5 and T78 (blue) for which NMR long-range NOEs (orange dashed lines) between the short N-terminal tail and the NTD were observed and equals to 4.9&#xa0;&#xc5; and 3.2&#xa0;&#xc5; respectively. <bold>(C and E)</bold> show the residues V35 and L177 (yellow) and A131 and V89 (cyan) for which long-range NOEs between the NTD and the long C-terminal tail were detected and equals to 3.3&#xa0;&#xc5; and 2.3&#xa0;&#xc5; respectively. (PDB ID:8AOU). Adapted from <xref ref-type="bibr" rid="B163">Wang et al. (2023)</xref>.</p>
</caption>
<graphic xlink:href="fchem-13-1597656-g006.tif">
<alt-text content-type="machine-generated">D</alt-text>
</graphic>
</fig>
<p>Wang and coworkers solved the solution NMR structure of SARS-CoV-2 full-length Nsp1 (PDB ID: 8AOU) (<xref ref-type="bibr" rid="B163">Wang et al., 2023</xref>). They demonstrated, <italic>via</italic> 3D NOESY experiments, the interactions between the tails and the globular domain. As a result, it was pinpointed that the interplay between the folded NTD and the disordered C-terminal tail is required for the Nsp1 mechanism at the base of its regulation activity. For example, long-range NOEs were observed between the side chains of L4 and L122 and between V5 and T78. The unambiguous NOEs which were reproduced in all structures of the NMR ensemble indicate that residue L177 of the CTD contacts V35 of the core domain while in the side chains of NTD (<xref ref-type="fig" rid="F6">Figure 6C</xref>), V89 contacts A131 of the linker region (<xref ref-type="fig" rid="F6">Figure 6E</xref>), W161 of the flexible C-terminal tail contacts residues R43 and K125 of the N-terminal domain. This latter residue belongs to the conserved amino acid motif (LRKxGKG) that was found to be important for the RNA-binding activity of Nsp1. Moreover, the residues in the CTD that form helices interacting with the 40S ribosomal subunit in the Cryo-EM structure of Nsp1 (<xref ref-type="bibr" rid="B138">Schubert et al., 2020</xref>) are mostly disordered in free Nsp1. Thus, in the free form, C-terminal residues tend to interact with NTD, as an interaction was observed at W161 and L177 on the surface of the Nsp1 NTD (<xref ref-type="bibr" rid="B163">Wang et al., 2023</xref>). Another concept that seems controversial is the binding of SARS-CoV-2 Nsp1 to SL1 without the ribosome. Some studies suggest a 40S ribosome-mediated association between Nsp1 and the 5&#x2032;UTR of viral mRNA (<xref ref-type="bibr" rid="B103">Mendez et al., 2021</xref>; <xref ref-type="bibr" rid="B149">Tidu et al., 2021</xref>); others also observed a direct interaction between SARS-CoV-2 5&#x2032;UTR RNA and the Nsp1-NTD (<xref ref-type="bibr" rid="B141">Vora et al., 2022</xref>). However, Wang et al. clearly demonstrated that free Nsp1 has no binding affinity for both the full-length and stem-loop constructs of RNAs derived from the 5&#x2032;UTR region of the SARS-CoV-2 genome. The authors further propose that the interaction of the C-terminal tail with the positively charged surface of the Nsp1 NTD may prevent non-specific RNA binding due to functional interplay between the two domains.</p>
<p>Wang et al. also uncovered the critical role of NTD in 40S-mediated viral mRNA recognition and promotion of viral gene expression. Nsp1 NTD, the linker, and the C-terminal tail are all involved in recruiting mRNA, further implicating that the intramolecular interaction and communication between the domains is required for the biological activity of Nsp1. Moreover, to validate the role of the linker, Shi et al. made Nsp1 constructs with different lengths of the linker between the Nsp1-N terminal domain and the Nsp1-C terminal domain. Accordingly, Nsp1 constructs with a linker domain extended beyond 20 residues were incapable of supporting viral translation, underscoring the significance of this spacer in the regulation of Nsp1 activity (<xref ref-type="bibr" rid="B141">Vora et al., 2022</xref>). Furthermore, upon binding of viral 5&#x2032; UTR to the Nsp1-NTD, the linker undergoes conformational changes that, in turn, significantly decrease the interaction of the CTD domain with the mRNA entry site of the 40S ribosome (<xref ref-type="bibr" rid="B103">Mendez et al., 2021</xref>; <xref ref-type="bibr" rid="B149">Tidu et al., 2021</xref>).</p>
</sec>
</sec>
<sec id="s4">
<title>4 The role or association of IDP sites with variants of SARS-CoV-2 and infection</title>
<p>As discussed in the previous sections, the interaction of N-protein with the genomic RNA and other membrane proteins is a vital process for the assembly and release of new virions. To get insights into the evolution of drug resistance mutations, it is imperative to comprehend the mechanisms by which mutations are rectified by the virus. In this part, we summarize the contribution IDRs and IDPs across the SARS-CoV-2 genome in bearing mutations, modulating the protein functions and association with variants of SARS-Cov-2.</p>
<p>Genetic variations across the SARS-CoV-2 genome are associated with the frequency of variants, the transmissibility of the virus, and the anti-viral immune response of the host. Mutations in different proteins govern viral replication efficiency, transmissibility, and virulence properties. In the same scenario, mutations affect the properties of proteins and IDR patterns; they may increase as well the size of the IDRs, all of which have an essential effect on folding and SARS-CoV-2 pathogenesis. As IDRs mediate coronavirus transmission (<xref ref-type="bibr" rid="B54">Goh et al., 2020</xref>; <xref ref-type="bibr" rid="B150">Tomaszewski et al., 2020</xref>; <xref ref-type="bibr" rid="B125">Podder et al., 2021</xref>), offering also sequence and structural flexibility, they are believed critical for immune evasion and antibody escape (<xref ref-type="bibr" rid="B126">Quaglia et al., 2022</xref>; <xref ref-type="bibr" rid="B92">Li et al., 2024</xref>) through diversification and adaptation within its new host.</p>
<p>Several lines of experimental and computational studies were accomplished soon after the emergence of the pandemic, clearly demonstrating that expansion and frameshift of mutations, including the dominant variants of N and S proteins, mainly emerge across the intrinsic disorder regions in the SARS-CoV-2 proteome. This points out the vital role of IDPs in the emergence of new variants and higher transmissibility than previous SARS&#x2010;coronaviruses (<xref ref-type="bibr" rid="B126">Quaglia et al., 2022</xref>; <xref ref-type="bibr" rid="B47">Feng et al., 2024</xref>; <xref ref-type="bibr" rid="B46">Fang et al., 2021</xref>).</p>
<p>The infection of SARS-CoV-2 in humans requires S proteins, which bind to the human ACE2 proteins. Particularly, several disordered regions in the receptor binding domains (RBDs) of Sprotein facilitate the interaction (<xref ref-type="bibr" rid="B176">Yesudhas et al., 2021</xref>). Multiple studies observed numerous pairwise interactions within unstructured regions while examining the atomic interaction between SARS-CoV-2 and ACE2 (<xref ref-type="bibr" rid="B13">Bhattacharjee et al., 2021</xref>; <xref ref-type="bibr" rid="B24">Celik et al., 2021</xref>; <xref ref-type="bibr" rid="B105">Michelitsch and Weissman, 2000</xref>; <xref ref-type="bibr" rid="B21">Campbell et al., 2021</xref>).</p>
<p>The mode of transmission and rigidity of the coronavirus outer shell appeared to be influenced by the unstructured region of Membrane and Envelope proteins (<xref ref-type="bibr" rid="B54">Goh et al., 2020</xref>), confirming the strong association between variants of SARS-CoV-2 and its intrinsically disordered regions (<xref ref-type="bibr" rid="B126">Quaglia et al., 2022</xref>; <xref ref-type="bibr" rid="B56">Gomari et al., 2023</xref>; <xref ref-type="bibr" rid="B142">Sinha and Roy, 2023</xref>; <xref ref-type="bibr" rid="B175">Ye et al., 2021</xref>).</p>
<p>From the analysis of 219.909 SARS-CoV-2 N sequences, most mutations localized in the intrinsically disordered regions, particularly in the SR-rich linker region (<xref ref-type="bibr" rid="B179">Zachrdla et al., 2022</xref>), that were as such believed to be the culprits in increasing the spread of the SARS-CoV-2 virus (<xref ref-type="bibr" rid="B74">Johnson et al., 2022</xref>; <xref ref-type="bibr" rid="B127">Rahman et al., 2021</xref>).</p>
<p>At the early stages of the SARS-CoV-2 outbreak, the increased spread of variants, including B.1.617.2 (Delta), which contains the R203M mutation has been noticed. Later on, this mutation (R203M) in N and D614G in S were documented along with the other six mutations (P323L in Nsp12, D614G in S, the T492I in Nsp4, R203M in N, T60A in Orf9b, and P1228L in Nsp3) that had greater than 50% frequency in the global SARS-CoV-2 mutations (<xref ref-type="bibr" rid="B1">Abbasian et al., 2023</xref>).</p>
<p>In a general context, the diversity of structural ensembles for proteins and protein-protein complexes can be explained by the major concepts of frustration and fuzziness. As illustrated in <xref ref-type="fig" rid="F5">Figure 5</xref>, researchers used the terms frustration to describe conformational variations in proteins and fuzziness to describe how conformational heterogeneity occurs in protein complexes involving IDRs (<xref ref-type="bibr" rid="B48">Freiberger et al., 2021</xref>; <xref ref-type="bibr" rid="B51">Gianni et al., 2021</xref>). In this regard, Haque et al. analyzed 228 mutations from each domain of the N protein of the SARS-CoV-2. Accordingly, 11 mutations are predicted to be deleterious and destabilizing. Among these mutations, R32C, R191C, and R203&#x2009;M mutations are localized in the disordered regions and show a significant change in frustration state (from neutral frustrated to major minimally frustrated state), which could raise the sampling of conformation space (<xref ref-type="bibr" rid="B61">Haque et al., 2023</xref>). It is worth noting that the R203M mutation improves RNA packaging mechanism and production of higher titers of infectious virions (<xref ref-type="bibr" rid="B61">Haque et al., 2023</xref>; <xref ref-type="bibr" rid="B144">Syed et al., 2021</xref>).</p>
<p>Phosphorylation of the SARS-CoV-2 Nucleoprotein recruits human cytosolic 14-3-3 proteins, essential for virus replication. 14-3-3 isoforms have the highest expressed rate in a number of tissues, including the brain, lungs, and gastrointestinal system. A recent study predicts the effect of N mutations on the interaction of N protein with human cytosolic 14-3-3 proteins. The S202R mutation demonstrates the profound effect on the efficiency of N protein to package RNA. R203K/G204R mutations, that occurred in the IDRs, appear to enhance the interaction with the 14-3-3 binding motif due to a predicted Arg204:Asp225 salt bridge (<xref ref-type="bibr" rid="B153">Tugaeva et al., 2023</xref>). Moreover, it was observed that the arginine at site 203 decreased in prevalence by 8.33% (from 81.9% to 73.5%) as the incidence of a lysine variant increased by 8.2% (from 18.12% to 26.32%). The glycine residue of the directly adjacent 204 site was exchanged by an arginine, increasing of 8.2% the incidence of the mutation (from 18.1% to 26.3%) (<xref ref-type="bibr" rid="B150">Tomaszewski et al., 2020</xref>). These results underscore the importance of these specific mutations in contributing to the function of the disordered SR rich region of the protein. Notably, SR rich region in the IDR2 of the N protein that includes the R203K mutation was the hot spot harboring 7 of the top 10 most frequent mutations (<xref ref-type="bibr" rid="B181">Zhao et al., 2021</xref>). Mutant proteins bearing mutations in these regions resulted in noticeably weaker phase separation with respect to the wild-type N protein. As confirmed by deep sequence data analysis of SARS-CoV-2 from public databases and clinical samples, the R203K/G204R variant was also associated with novel transcription-regulating sequence-core sequence-dimerization domain RNA, that is supposed to have an increased effect on the expression of sub-genomic RNA (<xref ref-type="bibr" rid="B89">Leary et al., 2021</xref>).</p>
<p>Another important aspect of mutations is their role in modulating the viral-host protein-protein interaction. Interestingly, Del Veliz et al. suggested the presence of compensatory mutations in N disordered regions containing binding motifs for 14-3-3 proteins. From analysis of the variability of about 90, 000 sequences of the SARS-CoV-2 N protein, it has been observed that most residues were highly conserved within the 14-3-3 binding site. Moreover, the compensatory mutations, including half of the variants of concern, were found to maintain the interaction energy of N-14-3-3&#x3b3; which is suggested to be beneficial for the virus (<xref ref-type="bibr" rid="B39">Del et al., 2021</xref>).</p>
<p>Protein-protein interactions are initiated by molecular recognition features (MoRFs) (<xref ref-type="bibr" rid="B111">Mohan et al., 2006</xref>; <xref ref-type="bibr" rid="B83">Kotta-Loizou et al., 2013</xref>), the abundance of which is highly associated with the amount of intrinsic disorder in different forms of life (<xref ref-type="bibr" rid="B171">Yan et al., 2016</xref>). MoRFs are small disordered regions situated within intrinsic disorder proteins or regions that undergo a disorder-to-order structure arrangement during interaction with their partners (<xref ref-type="bibr" rid="B60">Gypas et al., 2013</xref>; <xref ref-type="bibr" rid="B108">Mishra et al., 2018</xref>).</p>
<p>Short linear motifs often located in intrinsically disordered regions offer a mechanism to hijack a large number of host processes (<xref ref-type="bibr" rid="B155">Van Roey et al., 2013</xref>; <xref ref-type="bibr" rid="B156">Van Roey et al., 2012</xref>). In SARS-CoV-2, nearly all proteins are predicted to have a significant percentage of MoRFs (<xref ref-type="bibr" rid="B52">Giri et al., 2021</xref>) suggesting the role of IDRs in protein-protein interaction networks. It has been observed that the replacement of hydrophobic to polar and charged amino acids in S glycoproteins of SARS&#x2010;CoV-2 creates an intrinsically disordered region that facilitates proteolysis and fusion with the host membrane (<xref ref-type="bibr" rid="B125">Podder et al., 2021</xref>). The antigenicity of the SARS-CoV-2 is due to the structural flexibility of its surface proteins. In S glycoproteins, mutation&#x2010;driven accumulation of intrinsically disordered residues has been noticed and hypothesized to enhance viral transmissibility. This overlap between IDRs and major antigenic sites in the receptor-binding domain and N-terminal domain of S glycoprotein (S1 subunit) (<xref ref-type="bibr" rid="B126">Quaglia et al., 2022</xref>) is further implicated in the virus to provide genetic and antigenic drift.</p>
<p>While the mutations that originated in the intrinsically disordered regions improved the viral fitness and affected the interaction with the human proteins, it is possible that they influence protein folding and glycosylation leading to structural modifications. Studies by Fang et al. reported nonsynonymous single nucleotide variants (SNVs) on more than 60% of each S, ORF1ab, and ORF3a, with significantly higher SNV occurrence ratios in IDRs of S and ORF1ab. The authors observed mutations in the IDRs of S located near N&#x2010;linked glycan sites, postulating potential impacts on glycosylation and protein folding, as well as on elevated levels of hydrophobicity (in S, ORF1ab, but not in ORF3a) (<xref ref-type="bibr" rid="B46">Fang et al., 2021</xref>).</p>
<p>Single mutations can affect the intrinsic disorder predisposition of viral proteins. In their per-residue disorder analysis, Hassan et al. used predisposition scores from 0 to one for the per-residual conditions, where 0 and one indicate residues entirely arranged and completely disordered, respectively. Accordingly, with different degrees of disorder predisposition, they observed that single mutations had a pronounced effect on the intrinsic disorder predisposition of ORF10 at the N- and C- terminal of its regions (<xref ref-type="bibr" rid="B62">Hassan et al., 2022</xref>). Mutations that emerge on the intrinsic disordered regions, could also lead to the development of drug and vaccine resistance. For example, as compared to wild type, receptor-binding domain mutants of Omicron, Delta AY.1, AY.2, and AY.3 were determined to be more disordered (<xref ref-type="bibr" rid="B129">Ranjan et al., 2022</xref>). This increase in disorder could perturb the interactions with antibodies, thus favoring the virus for antibody escape and, as a consequence leading to more pathogenicity.</p>
<p>It is also possible that mutations at the IDRs may lead to structure destabilization. For example, both SARS-CoV-2 and SARS-CoV-1 deletion and substitution mutations of Nsp1 in the C-terminal motif IDR significantly destabilize the structure of Nsp1 (<xref ref-type="bibr" rid="B131">Rezaei et al., 2022</xref>). In fact, point mutations at R99 and residues Arg124-Lys125 near the predicted unstructured regions of Nsp1 also lead to the loss of its ability to recognize viral RNA (<xref ref-type="bibr" rid="B103">Mendez et al., 2021</xref>; <xref ref-type="bibr" rid="B95">Lokugamage et al., 2012</xref>). Also interestingly, K129E and G130R mutations at the beginning of the intrinsically disordered C-terminal domain strongly reduced the ability of SARS-CoV-2 Nsp1 to inhibit cellular translation (<xref ref-type="bibr" rid="B49">Frolov et al., 2023</xref>).</p>
</sec>
<sec id="s5">
<title>5 SARS-CoV-2 IDRs and signaling pathways of the host cell</title>
<p>The unusually large genome of coronaviruses provides high structural complexity and intricate molecular interaction to efficiently replicate their genome. Once inside the infected cells, a spatiotemporal-oriented coordination between a cohort of enzymes, supporting proteins, and the host multiple factors, is required to produce viral mRNAs and new genomes. All stages of the life cycles of SARS-CoV-2 rely on host factors (<xref ref-type="bibr" rid="B80">Kim et al., 2020</xref>; <xref ref-type="bibr" rid="B183">Zhou et al., 2020</xref>), and hundreds of human proteins have been found to interact with viral proteins (<xref ref-type="bibr" rid="B16">Bouhaddou et al., 2020</xref>; <xref ref-type="bibr" rid="B38">Davidson et al., 2020</xref>; <xref ref-type="bibr" rid="B57">Gordon et al., 2020</xref>; <xref ref-type="bibr" rid="B91">Li et al., 2021</xref>).</p>
<p>In their large-scale proteomic analysis, Gordon et al. identified SARS-CoV-2 proteins interacting with human proteins involved in innate immune pathways, host translation machinery, cullin ubiquitin ligase, and bromodomain proteins (<xref ref-type="bibr" rid="B57">Gordon et al., 2020</xref>). Li and coworkers also identified 286 potential host targets using quantitative proteomic analysis approaches on SARS-CoV-2 intra-viral protein-protein interactions and virus-host interaction networks in human cells (<xref ref-type="bibr" rid="B91">Li et al., 2021</xref>). These findings further outline how the host cell infrastructure and metabolism ultimately determine the viral progeny.</p>
<p>In this section, we emphasize the importance of IDRs in SARS-CoV-2 by scrutinizing biochemical, structural, and virological experimental studies of selected viral proteins (<xref ref-type="table" rid="T1">Table 1</xref>), whose function includes IDRs/IDPs involvement in the host signaling machinery. However, the complete molecular mechanism of interaction of the virus protein with host proteins is not mentioned here because it is outside the scope of this review.</p>
<table-wrap id="T1" position="float">
<label>TABLE 1</label>
<caption>
<p>Some selected examples of the potential involvement of intrinsically disordered regions of SARS-CoV-2 proteins in host signaling machinery.</p>
</caption>
<table>
<thead valign="top">
<tr>
<th align="left">Viral components/IDR</th>
<th align="left">Unstructured<break/>Region</th>
<th align="left">IDR length/location</th>
<th align="left">MoRF motif sequence<xref ref-type="table-fn" rid="Tfn1">
<sup>a</sup>
</xref>
</th>
<th align="left">Experimental assay</th>
<th align="left">Role in host machinery</th>
<th align="left">Change/response/effect on the host</th>
<th align="left">References</th>
</tr>
</thead>
<tbody valign="top">
<tr>
<td rowspan="2" align="left">
<bold>N</bold>
</td>
<td rowspan="2" align="left">Mostly in the N terminus</td>
<td rowspan="2" align="left">Residues 1&#x2013;48, 175&#x2013;248, 365&#x2013;419</td>
<td rowspan="2" align="left">
<sup>1</sup>MSDNGPQNQRNAPRITFGGPSDSTGSNQNGER<sup>20</sup>, <sup>82</sup>DQIGYYRRATRRIRGGD<sup>98</sup>, <sup>102</sup>KDLSPRWYFYYLGTGPE<sup>118</sup>,<break/>
<sup>403</sup>FSKQLQQ<sup>409</sup>
</td>
<td align="left">Analytical size-exclusion chromatography (SEC)</td>
<td align="left">Interacts with seven human 14-3-3 isoforms<xref ref-type="table-fn" rid="Tfn3">
<sup>c</sup>
</xref>
</td>
<td align="left">Could hijack cellular pathways by 14-3-3 sequestration</td>
<td align="left">
<xref ref-type="bibr" rid="B39">Del et al. (2021),</xref> <xref ref-type="bibr" rid="B152">Tugaeva et al. (2021)</xref>
</td>
</tr>
<tr>
<td align="left">
<italic>In vitro</italic> host-SARS-CoV-2 interactome, Y2H and TMT-AP&#x2013;MS</td>
<td align="left">Interacts LARP1 and RRP9</td>
<td align="left">Downregulation of LARP1 phosphorylation<break/>Inhibition of protein synthesis</td>
<td align="left">
<xref ref-type="bibr" rid="B57">Gordon et al. (2020),</xref> <xref ref-type="bibr" rid="B184">Zhou et al. (2023)</xref>
</td>
</tr>
<tr>
<td align="left">
<bold>ORF6</bold>
</td>
<td align="left">Mostly the C-terminal<xref ref-type="table-fn" rid="Tfn1">
<sup>a</sup>
</xref>
</td>
<td align="left">Residues 45&#x2013;60</td>
<td align="left">
<sup>14</sup>ILLIIMRT<sup>21</sup>, <sup>26</sup>IWNLDYIINLIIKNLSKSLTENKYSQLDEEQPMEID<sup>61</sup>
</td>
<td align="left">
<italic>In vitro</italic> host-SARS-CoV-2 interactome</td>
<td align="left">Interacts with NUP98/RAE complex</td>
<td align="left">Prevents host mRNA export through the nuclear pore</td>
<td align="left">
<xref ref-type="bibr" rid="B57">Gordon et al. (2020)</xref>
</td>
</tr>
<tr>
<td align="left">
<bold>ORF3a</bold>
</td>
<td align="left">N-terminus, and C-terminus<xref ref-type="table-fn" rid="Tfn1">
<sup>a</sup>
</xref>
</td>
<td align="left">Residues 1&#x2013;19, 261&#x2013;268</td>
<td align="left">
<sup>1</sup>MDLFMR<sup>6</sup>, <sup>261</sup>EPIYDEPT<sup>268</sup>
</td>
<td align="left">
<italic>In vitro</italic> host-SARS-CoV-2 interactome, Y2H and TMT-AP&#x2013;MS</td>
<td align="left">Binds TRIM59 and other HOPS complex proteins</td>
<td align="left">Endoplasmic reticulum stress</td>
<td align="left">
<xref ref-type="bibr" rid="B57">Gordon et al. (2020),</xref> <xref ref-type="bibr" rid="B91">Li et al. (2021)</xref>; <xref ref-type="bibr" rid="B184">Zhou et al. (2023)</xref>
</td>
</tr>
<tr>
<td align="left">
<bold>Nsp1</bold>
</td>
<td align="left">C-terminal</td>
<td align="left">Residues 148&#x2013;180</td>
<td align="left">
<sup>64</sup>LEQPYVFIKRSDA<sup>75</sup>, <sup>93</sup>EGIQ<sup>97</sup>, <sup>99</sup>RSGETLGVLVPHVGEIPVAYRKVLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTRELMRELNG<sup>179</sup>
</td>
<td align="left">Cryo&#x2013;electron<break/>Microscopy, <italic>In vitro</italic> binding assay</td>
<td align="left">Interacts with 40s ribosome</td>
<td align="left">Mediates translation shutoff</td>
<td align="left">
<xref ref-type="bibr" rid="B148">Thoms et al. (2020),</xref> <xref ref-type="bibr" rid="B49">Frolov et al. (2023)</xref>
</td>
</tr>
<tr>
<td align="left">
<bold>Nsp8</bold>
</td>
<td align="left">Mostly at the middle (residues 40&#x2013;84<xref ref-type="table-fn" rid="Tfn1">
<sup>a</sup>
</xref>)</td>
<td align="left">Residues 40&#x2013;84</td>
<td align="left">
<sup>181</sup>AWPLI<sup>185</sup>
</td>
<td align="left">
<italic>In vitro</italic> host-SARS-CoV-2 interactome</td>
<td align="left">Interacts with SRPs components (SRP19, SRP54, SRP72)</td>
<td align="left">Hijacks the Sec61-mediated protein translocation pathway for entry into the endoplasmic reticulum</td>
<td align="left">
<xref ref-type="bibr" rid="B57">Gordon et al. (2020)</xref>
</td>
</tr>
</tbody>
</table>
<table-wrap-foot>
<fn id="Tfn1">
<label>
<sup>a</sup>
</label>
<p>The disorder prediction results, and.</p>
</fn>
<fn id="Tfn2">
<label>
<sup>b</sup>
</label>
<p>the predicted MoRF, motif sequences results are from <xref ref-type="bibr" rid="B52">Giri et al. (2021)</xref>. It should be noted that Giri et al. used several MoRFs, predictors that may show some variation in the results, and the MoRF, regions presented here in <xref ref-type="table" rid="T1">Table 1</xref> are drawn from the MoRFchibi_web predictor. The C-terminal sequence of SARS-CoV-2 ORF6, contains a trafficking motifs 46ENKYSQLDEEQPMEID61, and putative NUP98&#x2013;RAE, binding sequence<sup>56</sup> QPMEID61 <xref ref-type="bibr" rid="B57">Gordon et al. (2020)</xref>.</p>
</fn>
<fn id="Tfn3">
<label>
<sup>c</sup>
</label>
<p>A study shows that greater than 90% of 14-3-3 protein partners contain disordered regions, suggesting that intrinsically disordered regions are favored by 14-3-3 proteins <xref ref-type="bibr" rid="B20">Bustos and Iglesias (2006)</xref>.</p>
</fn>
<fn>
<p>Abbreviations: SRP, signal recognition particle; HOPS, homotypic fusion and protein sorting complex; LARP1, La-related protein 1; Y2H, yeast two-hybrid; TMT-AP&#x2013;MS, tandem mass tag affinity purification followed by mass spectrometry.</p>
</fn>
</table-wrap-foot>
</table-wrap>
<p>As was said earlier, intrinsically disordered protein regions evolve rapidly, promoting diversity and enabling interaction with multiple proteins among species (<xref ref-type="bibr" rid="B119">Ortiz et al., 2013</xref>; <xref ref-type="bibr" rid="B26">Chang et al., 2014</xref>) (<xref ref-type="bibr" rid="B53">Gitlin et al., 2014</xref>)<italic>.</italic> In SARS-CoV-2, ORF6 is one of the second-highest IDR-containing accessory proteins. ORF6 hijacks nucleocytoplasmic mRNA transport factors Nucleoporin 98 (NUP98) and RNA export factor 1 (RAE1) (<xref ref-type="bibr" rid="B107">Miorin et al., 2020</xref>; <xref ref-type="bibr" rid="B110">Miyamoto et al., 2022</xref>; <xref ref-type="bibr" rid="B78">Kato et al., 2021</xref>). Using its C-terminal residues directly binds to transcription factors, signal transducers, and activators of transcription (STAT1) and inhibits its nuclear localization, therefore changing subcellular localization and resulting in downregulation of the interferon (IFN) pathway (<xref ref-type="bibr" rid="B110">Miyamoto et al., 2022</xref>; <xref ref-type="bibr" rid="B90">Lei et al., 2020</xref>). Importantly, this protein contains a long MoRF region (residues 26&#x2013;61) near the C-terminal region (<xref ref-type="bibr" rid="B52">Giri et al., 2021</xref>), that matches with the residues 46&#x2013;61 comprising trafficking motifs and with putative NUP98&#x2013;RAE1 binding sequence (<xref ref-type="bibr" rid="B57">Gordon et al., 2020</xref>).</p>
<sec id="s5-1">
<title>5.1 Nucleocapsid and host cell interaction</title>
<p>Several lines of experimental and computational studies revealed that the intrinsic disorder regions of N protein contain putative binding sites for different host proteins (<xref ref-type="bibr" rid="B72">Jia et al., 2022</xref>; <xref ref-type="bibr" rid="B67">Huang et al., 2021</xref>; <xref ref-type="bibr" rid="B15">Biswal et al., 2022</xref>; <xref ref-type="bibr" rid="B39">Del et al., 2021</xref>; <xref ref-type="bibr" rid="B44">El-Maradny et al., 2024</xref>). As a result of a recent investigation, 77 coronavirus N&#x2010;interacting host proteins were examined, of which 33 are stress granule components, indicating a higher likelihood of IDRs to hijack SG proteins to the viral replication machinery (<xref ref-type="bibr" rid="B112">Moosa and Banerjee, 2020</xref>). It has been implicated that viral N&#x2010;mediated host subversion is associated with &#x3c0;&#x2010;&#x3c0;&#x2010;interactions between &#x3c0;&#x2010;rich disordered domains of coronavirus N and host proteins. This bioinformatics report is supported by experimental observations on the possible self&#x2010;association of &#x3c0;&#x2010;rich IDR&#x2010;2 <italic>via</italic> &#x3c0;&#x2010;&#x3c0; interactions (<xref ref-type="bibr" rid="B32">Cong et al., 2017</xref>). Likewise, IDR&#x2010;1 also promotes self&#x2010;interaction of SARS N (<xref ref-type="bibr" rid="B63">He et al., 2004</xref>). Furthermore, there is also a tight interaction of the &#x3c0;&#x2010;rich IDR&#x2010;2 of coronavirus N with the &#x3c0;&#x2010;rich disordered domain of heterogeneous nuclear ribonucleoprotein A1 (hnRNPA1) (<xref ref-type="bibr" rid="B97">Luo et al., 2005</xref>), all of which interactions contributes to suppress the host gene expression.</p>
<p>To fully understand the role of N-terminal IDR1, Huang et al., by means of GST pull-down and ITC assays, showed the key fragments for interaction between G3BP1/2 and N protein: the binding is mediated by N-IDR fragment (amino acids 11-24) and the NTF2 domain from the G3BP1 (G3BP1<sup>NTF2</sup>) (<xref ref-type="bibr" rid="B67">Huang et al., 2021</xref>). Another important finding regards the sequence termed ITFG motif, found in the N-IDR (residues 1&#x2013;48) region of the N protein. The motif shares similarity with that of a peptide known to interact with G3BP1<sup>NTF2</sup> and fully conserved in SARS-CoV: interestingly, all four residues contribute to the binding, with Isoleucine and Phenylalanine paramount. Furthermore, from truncation of the N protein, it was shown that both the N-IDR1 and N-terminal RNA recognition motif RRM (residues 49&#x2013;174) are required for inhibiting G3BP1-mediated LLPS (<xref ref-type="bibr" rid="B67">Huang et al., 2021</xref>). From another standpoint, the C-terminal domain (spanning residues from 248 to 365)-mediated inhibition of SG formation is not affected by disruption of the G3BP binding motif. On the other hand, alanine substitution in the C-terminal domain (248&#x2013;365), as, for example, K257A, K261A, and their combination, disrupt dsRNA binding and abrogate suppression of SG formation (<xref ref-type="bibr" rid="B7">Aloise et al., 2023</xref>).</p>
</sec>
<sec id="s5-2">
<title>5.2 Nsp1 and host cell interaction</title>
<p>Nsp1 interactions with human proteins are indispensable for the virus life cycle. The immune evasion and the control of cellular response relies on host mRNA degradation and translation shutoff. The major virulence factor, Nsp1, governs this process <italic>via</italic> direct ribosomal association (<xref ref-type="bibr" rid="B138">Schubert et al., 2020</xref>; <xref ref-type="bibr" rid="B141">Vora et al., 2022</xref>; <xref ref-type="bibr" rid="B95">Lokugamage et al., 2012</xref>; <xref ref-type="bibr" rid="B178">Yuan et al., 2020</xref>).</p>
<p>Nsp1 N-terminus domain of both SARS-CoV-1 and SARS-CoV-2 binds the first stem-loop in the viral 5&#x2032;leader sequence that guarantees continuous translation of the viral mRNA (<xref ref-type="bibr" rid="B145">Tanaka et al., 2012</xref>; <xref ref-type="bibr" rid="B141">Vora et al., 2022</xref>). Multiple structural and biochemical studies on coronaviruses demonstrated the C-terminal region as a key domain of Nsp1 that interacts with different ribosome subunits (<xref ref-type="bibr" rid="B138">Schubert et al., 2020</xref>; <xref ref-type="bibr" rid="B76">Kami et al., 2009</xref>; <xref ref-type="bibr" rid="B65">Huang et al., 2011</xref>; <xref ref-type="bibr" rid="B115">Nakagawa et al., 2016</xref>). Structural analysis by Cryo-electron microscopy evidenced that Nsp1 interacts with the 40S ribosomal subunit <italic>via</italic> residues conserved among coronaviruses, namely, Lys164 and His165. Thus, it leads to mRNA entry tunnel obstruction by C-terminus attachment. In consequence, the antiviral defense factor including RIG-I (retinoic acid-inducible gene-I) is suppressed by Nsp1. In fact, K164A and H165A mutants do not show binding, explaining the role of the two residues in the interaction with the 40S ribosome in both SARS-CoVs (<xref ref-type="bibr" rid="B148">Thoms et al., 2020</xref>; <xref ref-type="bibr" rid="B138">Schubert et al., 2020</xref>). Moreover, in the case of molecular interactions between Nsp1 and the 40S subunit, residues Y154, F157, and W161 in the first C-terminal helix (residues 153&#x2013;160) interact through their multiple hydrophobic side chains with uS5 and uS3 proteins (<xref ref-type="bibr" rid="B138">Schubert et al., 2020</xref>).</p>
<p>It is also observed that the conserved KH motif (i.e., K164 and H165 in the short loop) experiences stacking interactions with helix h18 of the 18S rRNA <italic>of the 40S subunit</italic>, thereby mediating the interaction in a conserved manner. The two C-terminal helices (i.e., the first helix (residues 153&#x2013;160) and the second helix (residues 166&#x2013;178) are connected by the KH motif. The other two conserved arginine R171 and R175 in the second helix make interactions with the phosphate backbone of h18 (<xref ref-type="bibr" rid="B138">Schubert et al., 2020</xref>). The uS3 subunit, which most likely corresponds to the Nsp1 unstructured linker, weakly interacts with h16. Furthermore, the C-terminal Nsp1 binds also 80S ribosomal complexes proving its role in the global translation inhibition (<xref ref-type="bibr" rid="B138">Schubert et al., 2020</xref>).</p>
<p>As highlighted in the previous sections, the efficient interplay between the NTD and C-terminal unstructured region is fundamental for Nsp1 interaction with host ribosomes (<xref ref-type="bibr" rid="B163">Wang et al., 2023</xref>).</p>
</sec>
</sec>
<sec id="s6">
<title>6 IDR-targeted therapeutics and future perspectives</title>
<p>IDPs have gained great attention and opened new insights for understanding the molecular mechanism of diseases beyond the classic structure-function paradigm. Nowadays, the structural and functional characterization of IDPs and IDRs is becoming essential and thus unveiling the roles of protein disorder in protein-protein and protein-nucleic acid interactions is a promising field in understanding the biology of many diseases. Thus, understanding viral IDPs/IDRs and their molecular recognition features is essential for grasping their role in protein function and drug design, especially in light of the fact that SARS-CoV-2 variants arise within intrinsically disordered regions (<xref ref-type="bibr" rid="B86">Kulkarni et al., 2025</xref>; <xref ref-type="bibr" rid="B59">Gupta and Uversky, 2024</xref>).</p>
<p>One of the SARS-CoV-2 proteins bearing the highest content of intrinsically disordered regions is the multifunctional nucleoprotein N. Its major biological function depends on the interplay between the folded domains and the intrinsically disordered regions. Being the N protein a RNA packaging protein, the importance of its disordered regions in RNA binding and as major phosphorylation site, leads to consider the IDRs of the N protein potential areas for future studies to develop therapeutics. As such, though the SR-rich intrinsically disordered region is identified as a preferential binding site to human 14-3-3 protein (<xref ref-type="bibr" rid="B39">Del et al., 2021</xref>), little is known about the fundamental biology of this region.</p>
<p>Thus, the host-viral interacting IDPs/IDRs could be targeted for different therapeutic strategies.</p>
<p>Indeed, the survival of the virus inside the host cell is guaranteed by the dynamic molecular interactions of intrinsically disordered regions of Nsp1 and host ribosome subunits; this protein hijacks the host ribosome, through the intrinsically disordered C-terminal domain and thereby leads to host gene shutoff. The fully comprehension of the Nsp1 role in SARS-CoV-2 pathogenesis definitely needs the characterization of Nsp1 structural and dynamical properties along with its molecular interactions.</p>
<p>Gordon et al. reported a comprehensive SARS-CoV-2 PPI network, and the drug-human target network, suggesting that SARS-CoV-2 proteins, such as Nsp8 and ORF6, whose interaction sequence comprises the IDR, show potential druggable targets (<xref ref-type="bibr" rid="B57">Gordon et al., 2020</xref>).</p>
<p>Mutations can significantly affect the physicochemical properties of proteins. For instance, it has been shown that mutations in the IDRs of N protein can have nonlocal impact and modulate thermodynamic stability, secondary structure, particle formation, protein oligomeric state, and LLPS (<xref ref-type="bibr" rid="B117">Nguyen et al., 2024</xref>). From another perspective, experimental studies demonstrated the impact of the spike protein D614G mutation that induces IDR-like segments to form &#x201c;order&#x2013;disorder&#x201d; transition (<xref ref-type="bibr" rid="B180">Zhang et al., 2021</xref>; <xref ref-type="bibr" rid="B40">Dokainish and Sugita, 2023</xref>). It has been further revealed that the order-disorder transition of IDRs in VOCs, which are associated with characteristic mutations such as D614G in the proximity of IDRs, controls the spike structure and dynamics (<xref ref-type="bibr" rid="B142">Sinha and Roy, 2023</xref>). This scenario opens an opportunity to target IDRs as remote operational switches for alternative therapeutic interventions. Moreover, as discussed above, IDRs show a helical propensity that possibly forms druggable conformational states. Interestingly enough, a recent study revealed that a small molecule to be evaluated in a clinical trial selectively interacts with an IDR oligomerization, further offering an insight that condensation and oligomerization could serve as key factors in the development of inhibitors for IDRs (<xref ref-type="bibr" rid="B14">Bielskut&#x117; et al., 2025</xref>).</p>
<p>Overall, although the presence of disordered regions could explain difficulties with crystallization of full-length N and Nsp1 proteins, deciphering the structural nuances of these proteins can provide important clues about potential therapeutic targets. Therefore, future studies should be oriented toward understanding the detailed mechanisms of intra- and intermolecular interactions of IDRs that may help to guide structure based therapeutics against SARS-CoV-2.</p>
</sec>
</body>
<back>
<sec sec-type="author-contributions" id="s7">
<title>Author contributions</title>
<p>GS: Writing &#x2013; original draft. NV: Writing &#x2013; original draft. GD: Writing &#x2013; original draft. MD: Writing &#x2013; original draft. EWM: Writing &#x2013; original draft. RF: Writing &#x2013; review and editing. RI: Writing &#x2013; review and editing. LR: Writing &#x2013; review and editing. CI: Writing &#x2013; review and editing. GM: Writing &#x2013; review and editing, Funding acquisition.</p>
</sec>
<sec sec-type="funding-information" id="s8">
<title>Funding</title>
<p>The author(s) declare that financial support was received for the research and/or publication of this article. This study was supported by the PRIN2022 granted from Italian Research Minister, grant n. 2022MBK24T.</p>
</sec>
<sec sec-type="COI-statement" id="s9">
<title>Conflict of interest</title>
<p>The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.</p>
</sec>
<sec sec-type="ai-statement" id="s10">
<title>Generative AI statement</title>
<p>The author(s) declare that no Generative AI was used in the creation of this manuscript.</p>
</sec>
<sec sec-type="disclaimer" id="s11">
<title>Publisher&#x2019;s note</title>
<p>All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.</p>
</sec>
<ref-list>
<title>References</title>
<ref id="B1">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Abbasian</surname>
<given-names>M. H.</given-names>
</name>
<name>
<surname>Mahmanzar</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Rahimian</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Mahdavi</surname>
<given-names>B.</given-names>
</name>
<name>
<surname>Tokhanbigli</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Moradi</surname>
<given-names>B.</given-names>
</name>
<etal/>
</person-group> (<year>2023</year>). <article-title>Global landscape of SARS-CoV-2 mutations and conserved regions</article-title>. <source>J. Transl. Med.</source> <volume>21</volume> (<issue>1</issue>), <fpage>152</fpage>. <pub-id pub-id-type="doi">10.1186/s12967-023-03996-w</pub-id>
</citation>
</ref>
<ref id="B2">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Abramson</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Adler</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Dunger</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Evans</surname>
<given-names>R.</given-names>
</name>
<name>
<surname>Green</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>Pritzel</surname>
<given-names>A.</given-names>
</name>
<etal/>
</person-group> (<year>2024</year>). <article-title>Accurate structure prediction of biomolecular interactions with AlphaFold 3</article-title>. <source>Nature</source> <volume>630</volume> (<issue>8016</issue>), <fpage>493</fpage>&#x2013;<lpage>500</lpage>. <pub-id pub-id-type="doi">10.1038/s41586-024-07487-w</pub-id>
</citation>
</ref>
<ref id="B3">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Abyzov</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Blackledge</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Zweckstetter</surname>
<given-names>M.</given-names>
</name>
</person-group> (<year>2022</year>). <article-title>Conformational dynamics of intrinsically disordered proteins regulate biomolecular condensate chemistry</article-title>. <source>Chem. Rev.</source> <volume>122</volume> (<issue>6</issue>), <fpage>6719</fpage>&#x2013;<lpage>6748</lpage>. <pub-id pub-id-type="doi">10.1021/acs.chemrev.1c00774</pub-id>
</citation>
</ref>
<ref id="B4">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Agback</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>Dominguez</surname>
<given-names>F.</given-names>
</name>
<name>
<surname>Frolov</surname>
<given-names>I.</given-names>
</name>
<name>
<surname>Frolova</surname>
<given-names>E. I.</given-names>
</name>
<name>
<surname>Agback</surname>
<given-names>P.</given-names>
</name>
</person-group> (<year>2021</year>). <article-title>1H, 13C and 15N resonance assignment of the SARS-CoV-2 full-length nsp1 protein and its mutants reveals its unique secondary structure features in solution</article-title>. <source>PloS One</source> <volume>16</volume> (<issue>12</issue>), <fpage>e0251834</fpage>. <pub-id pub-id-type="doi">10.1371/journal.pone.0251834</pub-id>
</citation>
</ref>
<ref id="B5">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Akbayrak</surname>
<given-names>I. Y.</given-names>
</name>
<name>
<surname>Caglayan</surname>
<given-names>S. I.</given-names>
</name>
<name>
<surname>Kurgan</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Uversky</surname>
<given-names>V. N.</given-names>
</name>
<name>
<surname>Coskuner-Weber</surname>
<given-names>O.</given-names>
</name>
</person-group> (<year>2022</year>). <article-title>Insights into the structural properties of SARS-CoV-2 main protease</article-title>. <source>Curr. Res. Struct. Biol.</source> <volume>4</volume>, <fpage>349</fpage>&#x2013;<lpage>355</lpage>. <pub-id pub-id-type="doi">10.1016/j.crstbi.2022.11.001</pub-id>
</citation>
</ref>
<ref id="B6">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Almeida</surname>
<given-names>M. S.</given-names>
</name>
<name>
<surname>Johnson</surname>
<given-names>M. A.</given-names>
</name>
<name>
<surname>Herrmann</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>Geralt</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>W&#xfc;thrich</surname>
<given-names>K.</given-names>
</name>
</person-group> (<year>2007</year>). <article-title>Novel &#x3b2;-barrel fold in the nuclear magnetic resonance structure of the replicase nonstructural protein 1 from the severe acute respiratory syndrome coronavirus</article-title>. <source>J. Virol.</source> <volume>81</volume> (<issue>7</issue>), <fpage>3151</fpage>&#x2013;<lpage>3161</lpage>. <pub-id pub-id-type="doi">10.1128/jvi.01939-06</pub-id>
</citation>
</ref>
<ref id="B7">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Aloise</surname>
<given-names>C.</given-names>
</name>
<name>
<surname>Schipper</surname>
<given-names>J. G.</given-names>
</name>
<name>
<surname>van Vliet</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Oymans</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Donselaar</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>Hurdiss</surname>
<given-names>D. L.</given-names>
</name>
<etal/>
</person-group> (<year>2023</year>). <article-title>SARS-CoV-2 nucleocapsid protein inhibits the PKR-mediated integrated stress response through RNA-binding domain N2b</article-title>. <source>PLoS Pathogens</source>. <volume>19</volume>(<issue>8</issue>):<fpage>e1011582</fpage>. <pub-id pub-id-type="doi">10.1371/journal.ppat.1011582</pub-id>
</citation>
</ref>
<ref id="B8">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Alshehri</surname>
<given-names>M. A.</given-names>
</name>
<name>
<surname>Manee</surname>
<given-names>M. M.</given-names>
</name>
<name>
<surname>Alqahtani</surname>
<given-names>F. H.</given-names>
</name>
<name>
<surname>Al-Shomrani</surname>
<given-names>B. M.</given-names>
</name>
<name>
<surname>Uversky</surname>
<given-names>V. N.</given-names>
</name>
</person-group> (<year>2021</year>). <article-title>On the prevalence and potential functionality of an intrinsic disorder in the MERS-CoV proteome</article-title>. <source>Viruses</source> <volume>13</volume> (<issue>2</issue>), <fpage>339</fpage>. <pub-id pub-id-type="doi">10.3390/v13020339</pub-id>
</citation>
</ref>
<ref id="B9">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Anjum</surname>
<given-names>F.</given-names>
</name>
<name>
<surname>Mohammad</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>Asrani</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Shafie</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Singh</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Yadav</surname>
<given-names>D. K.</given-names>
</name>
<etal/>
</person-group> (<year>2022</year>). <article-title>Identification of intrinsically disorder regions in non-structural proteins of SARS-CoV-2: new insights into drug and vaccine resistance</article-title>. <source>Mol. Cell Biochem.</source> <volume>477</volume> (<issue>5</issue>), <fpage>1607</fpage>&#x2013;<lpage>1619</lpage>. <pub-id pub-id-type="doi">10.1007/s11010-022-04393-5</pub-id>
</citation>
</ref>
<ref id="B10">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Bai</surname>
<given-names>Z.</given-names>
</name>
<name>
<surname>Cao</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Liu</surname>
<given-names>W.</given-names>
</name>
<name>
<surname>Li</surname>
<given-names>J.</given-names>
</name>
</person-group> (<year>2021</year>). <article-title>The SARS-CoV-2 nucleocapsid protein and its role in viral structure, biological functions, and a potential target for drug or vaccine mitigation</article-title>. <source>Viruses</source> <volume>13</volume> (<issue>6</issue>), <fpage>1115</fpage>. <pub-id pub-id-type="doi">10.3390/v13061115</pub-id>
</citation>
</ref>
<ref id="B11">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Barik</surname>
<given-names>S.</given-names>
</name>
</person-group> (<year>2020</year>). <article-title>Genus-specific pattern of intrinsically disordered central regions in the nucleocapsid protein of coronaviruses</article-title>. <source>Comput. Struct. Biotechnol. J.</source> <volume>18</volume>, <fpage>1884</fpage>&#x2013;<lpage>1890</lpage>. <pub-id pub-id-type="doi">10.1016/j.csbj.2020.07.005</pub-id>
</citation>
</ref>
<ref id="B12">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Bessa</surname>
<given-names>L. M.</given-names>
</name>
<name>
<surname>Guseva</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Camacho-Zarco</surname>
<given-names>A. R.</given-names>
</name>
<name>
<surname>Salvi</surname>
<given-names>N.</given-names>
</name>
<name>
<surname>Maurin</surname>
<given-names>D.</given-names>
</name>
<name>
<surname>Perez</surname>
<given-names>L. M.</given-names>
</name>
<etal/>
</person-group> (<year>2022</year>). <article-title>The intrinsically disordered SARS-CoV-2 nucleoprotein in dynamic complex with its viral partner nsp3a</article-title>. <source>Sci. Adv.</source> <volume>8</volume> (<issue>3</issue>), <fpage>eabm4034</fpage>. <pub-id pub-id-type="doi">10.1126/sciadv.abm4034</pub-id>
</citation>
</ref>
<ref id="B13">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Bhattacharjee</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Bhattacharyya</surname>
<given-names>R.</given-names>
</name>
<name>
<surname>Sengupta</surname>
<given-names>J.</given-names>
</name>
</person-group> (<year>2021</year>). <article-title>Dynamics and electrostatics define an allosteric druggable site within the receptor&#x2010;binding domain of SARS&#x2010;CoV&#x2010;2 spike protein</article-title>. <source>FEBS Lett.</source> <volume>595</volume> (<issue>4</issue>), <fpage>442</fpage>&#x2013;<lpage>451</lpage>. <pub-id pub-id-type="doi">10.1002/1873-3468.14038</pub-id>
</citation>
</ref>
<ref id="B14">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Bielskut&#x117;</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Mateos</surname>
<given-names>B.</given-names>
</name>
<name>
<surname>Awawdy</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Garcia-Cabau</surname>
<given-names>C.</given-names>
</name>
<name>
<surname>Niskanen</surname>
<given-names>H.</given-names>
</name>
<name>
<surname>S&#xe1;nchez-Zarzalejo</surname>
<given-names>C.</given-names>
</name>
<etal/>
</person-group> (<year>2025</year>). <article-title>Oligomerization enables the selective targeting of intrinsically disordered regions by small molecules</article-title>. <source>bioRxiv Prepr. Serv. Biol.</source> <comment>2025.03. 21.644603</comment>. <pub-id pub-id-type="doi">10.1101/2025.03.21.644603</pub-id>
</citation>
</ref>
<ref id="B15">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Biswal</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Lu</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Song</surname>
<given-names>J.</given-names>
</name>
</person-group> (<year>2022</year>). <article-title>SARS-CoV-2 nucleocapsid protein targets a conserved surface groove of the NTF2-like domain of G3BP1</article-title>. <source>J. Mol. Biol.</source> <volume>434</volume> (<issue>9</issue>), <fpage>167516</fpage>. <pub-id pub-id-type="doi">10.1016/j.jmb.2022.167516</pub-id>
</citation>
</ref>
<ref id="B16">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Bouhaddou</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Memon</surname>
<given-names>D.</given-names>
</name>
<name>
<surname>Meyer</surname>
<given-names>B.</given-names>
</name>
<name>
<surname>White</surname>
<given-names>K. M.</given-names>
</name>
<name>
<surname>Rezelj</surname>
<given-names>V. V.</given-names>
</name>
<name>
<surname>Marrero</surname>
<given-names>M. C.</given-names>
</name>
<etal/>
</person-group> (<year>2020</year>). <article-title>The global phosphorylation landscape of SARS-CoV-2 infection</article-title>. <source>Cell</source> <volume>182</volume> (<issue>3</issue>), <fpage>685</fpage>&#x2013;<lpage>712.e19</lpage>. <pub-id pub-id-type="doi">10.1016/j.cell.2020.06.034</pub-id>
</citation>
</ref>
<ref id="B17">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Bowman</surname>
<given-names>M. A.</given-names>
</name>
<name>
<surname>Riback</surname>
<given-names>J. A.</given-names>
</name>
<name>
<surname>Rodriguez</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Guo</surname>
<given-names>H.</given-names>
</name>
<name>
<surname>Li</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Sosnick</surname>
<given-names>T. R.</given-names>
</name>
<etal/>
</person-group> (<year>2020</year>). <article-title>Properties of protein unfolded states suggest broad selection for expanded conformational ensembles</article-title>. <source>Proc. Natl. Acad. Sci. U. S. A.</source> <volume>117</volume> (<issue>38</issue>), <fpage>23356</fpage>&#x2013;<lpage>23364</lpage>. <pub-id pub-id-type="doi">10.1073/pnas.2003773117</pub-id>
</citation>
</ref>
<ref id="B18">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Bugge</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Brakti</surname>
<given-names>I.</given-names>
</name>
<name>
<surname>Fernandes</surname>
<given-names>C. B.</given-names>
</name>
<name>
<surname>Dreier</surname>
<given-names>J. E.</given-names>
</name>
<name>
<surname>Lundsgaard</surname>
<given-names>J. E.</given-names>
</name>
<name>
<surname>Olsen</surname>
<given-names>J. G.</given-names>
</name>
<etal/>
</person-group> (<year>2020</year>). <article-title>Interactions by disorder &#x2013; a matter of context</article-title>. <source>Front. Mol. Biosci.</source> <volume>7</volume>, <fpage>110</fpage>. <pub-id pub-id-type="doi">10.3389/fmolb.2020.00110</pub-id>
</citation>
</ref>
<ref id="B19">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Bugge</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Staby</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Salladini</surname>
<given-names>E.</given-names>
</name>
<name>
<surname>Falbe-Hansen</surname>
<given-names>R. G.</given-names>
</name>
<name>
<surname>Kragelund</surname>
<given-names>B. B.</given-names>
</name>
<name>
<surname>Skriver</surname>
<given-names>K.</given-names>
</name>
</person-group> (<year>2021</year>). <article-title>&#x3b1;&#x3b1;-Hub domains and intrinsically disordered proteins: a decisive combo</article-title>. <source>J. Biol. Chem.</source> <volume>296</volume>, <fpage>100226</fpage>. <pub-id pub-id-type="doi">10.1074/jbc.rev120.012928</pub-id>
</citation>
</ref>
<ref id="B20">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Bustos</surname>
<given-names>D. M.</given-names>
</name>
<name>
<surname>Iglesias</surname>
<given-names>A. A.</given-names>
</name>
</person-group> (<year>2006</year>). <article-title>Intrinsic disorder is a key characteristic in partners that bind 14&#x2010;3&#x2010;3 proteins</article-title>. <source>Proteins Struct. Funct. Bioinforma.</source> <volume>63</volume> (<issue>1</issue>), <fpage>35</fpage>&#x2013;<lpage>42</lpage>. <pub-id pub-id-type="doi">10.1002/prot.20888</pub-id>
</citation>
</ref>
<ref id="B21">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Campbell</surname>
<given-names>F.</given-names>
</name>
<name>
<surname>Archer</surname>
<given-names>B.</given-names>
</name>
<name>
<surname>Laurenson-Schafer</surname>
<given-names>H.</given-names>
</name>
<name>
<surname>Jinnai</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Konings</surname>
<given-names>F.</given-names>
</name>
<name>
<surname>Batra</surname>
<given-names>N.</given-names>
</name>
<etal/>
</person-group> (<year>2021</year>). <article-title>Increased transmissibility and global spread of SARS-CoV-2 variants of concern as at June 2021</article-title>. <source>Eurosurveillance</source> <volume>26</volume> (<issue>24</issue>), <fpage>2100509</fpage>. <pub-id pub-id-type="doi">10.2807/1560-7917.es.2021.26.24.2100509</pub-id>
</citation>
</ref>
<ref id="B22">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Campen</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Williams</surname>
<given-names>R. M.</given-names>
</name>
<name>
<surname>Brown</surname>
<given-names>C. J.</given-names>
</name>
<name>
<surname>Meng</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Uversky</surname>
<given-names>V. N.</given-names>
</name>
<name>
<surname>Dunker</surname>
<given-names>A. K.</given-names>
</name>
</person-group> (<year>2008</year>). <article-title>TOP-IDP-scale: a new amino acid scale measuring propensity for intrinsic disorder</article-title>. <source>Protein Peptide Lett.</source> <volume>15</volume> (<issue>9</issue>), <fpage>956</fpage>&#x2013;<lpage>963</lpage>. <pub-id pub-id-type="doi">10.2174/092986608785849164</pub-id>
</citation>
</ref>
<ref id="B23">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Carlson</surname>
<given-names>C. R.</given-names>
</name>
<name>
<surname>Asfaha</surname>
<given-names>J. B.</given-names>
</name>
<name>
<surname>Ghent</surname>
<given-names>C. M.</given-names>
</name>
<name>
<surname>Howard</surname>
<given-names>C. J.</given-names>
</name>
<name>
<surname>Hartooni</surname>
<given-names>N.</given-names>
</name>
<name>
<surname>Safari</surname>
<given-names>M.</given-names>
</name>
<etal/>
</person-group> (<year>2020</year>). <article-title>Phosphoregulation of phase separation by the SARS-CoV-2 N protein suggests a biophysical basis for its dual functions</article-title>. <source>Mol. Cell</source> <volume>80</volume> (<issue>6</issue>), <fpage>1092</fpage>&#x2013;<lpage>103.e4</lpage>. <pub-id pub-id-type="doi">10.1016/j.molcel.2020.11.025</pub-id>
</citation>
</ref>
<ref id="B24">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Celik</surname>
<given-names>I.</given-names>
</name>
<name>
<surname>Yadav</surname>
<given-names>R.</given-names>
</name>
<name>
<surname>Duzgun</surname>
<given-names>Z.</given-names>
</name>
<name>
<surname>Albogami</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>El-Shehawi</surname>
<given-names>A. M.</given-names>
</name>
<name>
<surname>Idroes</surname>
<given-names>R.</given-names>
</name>
<etal/>
</person-group> (<year>2021</year>). <article-title>Interactions of the receptor binding domain of SARS-CoV-2 variants with hACE2: insights from molecular docking analysis and molecular dynamic simulation</article-title>. <source>Biology</source> <volume>10</volume> (<issue>9</issue>), <fpage>880</fpage>. <pub-id pub-id-type="doi">10.3390/biology10090880</pub-id>
</citation>
</ref>
<ref id="B25">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Chang</surname>
<given-names>C.-K.</given-names>
</name>
<name>
<surname>Hsu</surname>
<given-names>Y.-L.</given-names>
</name>
<name>
<surname>Chang</surname>
<given-names>Y.-H.</given-names>
</name>
<name>
<surname>Chao</surname>
<given-names>F.-A.</given-names>
</name>
<name>
<surname>Wu</surname>
<given-names>M.-C.</given-names>
</name>
<name>
<surname>Huang</surname>
<given-names>Y.-S.</given-names>
</name>
<etal/>
</person-group> (<year>2009</year>). <article-title>Multiple nucleic acid binding sites and intrinsic disorder of severe acute respiratory syndrome coronavirus nucleocapsid protein: implications for ribonucleocapsid protein packaging</article-title>. <source>J. Virol.</source> <volume>83</volume> (<issue>5</issue>), <fpage>2255</fpage>&#x2013;<lpage>2264</lpage>. <pub-id pub-id-type="doi">10.1128/jvi.02001-08</pub-id>
</citation>
</ref>
<ref id="B26">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Chang</surname>
<given-names>C.-k.</given-names>
</name>
<name>
<surname>Hou</surname>
<given-names>M.-H.</given-names>
</name>
<name>
<surname>Chang</surname>
<given-names>C.-F.</given-names>
</name>
<name>
<surname>Hsiao</surname>
<given-names>C.-D.</given-names>
</name>
<name>
<surname>Huang</surname>
<given-names>T.-h.</given-names>
</name>
</person-group> (<year>2014</year>). <article-title>The SARS coronavirus nucleocapsid protein &#x2013; forms and functions</article-title>. <source>Antivir. Res.</source> <volume>103</volume>, <fpage>39</fpage>&#x2013;<lpage>50</lpage>. <pub-id pub-id-type="doi">10.1016/j.antiviral.2013.12.009</pub-id>
</citation>
</ref>
<ref id="B27">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Chen</surname>
<given-names>C.-Y.</given-names>
</name>
<name>
<surname>Chang</surname>
<given-names>C.-k.</given-names>
</name>
<name>
<surname>Chang</surname>
<given-names>Y.-W.</given-names>
</name>
<name>
<surname>Sue</surname>
<given-names>S.-C.</given-names>
</name>
<name>
<surname>Bai</surname>
<given-names>H.-I.</given-names>
</name>
<name>
<surname>Riang</surname>
<given-names>L.</given-names>
</name>
<etal/>
</person-group> (<year>2007</year>). <article-title>Structure of the SARS coronavirus nucleocapsid protein RNA-binding dimerization domain suggests a mechanism for helical packaging of viral RNA</article-title>. <source>J. Mol. Biol.</source> <volume>368</volume> (<issue>4</issue>), <fpage>1075</fpage>&#x2013;<lpage>1086</lpage>. <pub-id pub-id-type="doi">10.1016/j.jmb.2007.02.069</pub-id>
</citation>
</ref>
<ref id="B28">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Chen</surname>
<given-names>H.</given-names>
</name>
<name>
<surname>Gill</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Dove</surname>
<given-names>B. K.</given-names>
</name>
<name>
<surname>Emmett</surname>
<given-names>S. R.</given-names>
</name>
<name>
<surname>Kemp</surname>
<given-names>C. F.</given-names>
</name>
<name>
<surname>Ritchie</surname>
<given-names>M. A.</given-names>
</name>
<etal/>
</person-group> (<year>2005</year>). <article-title>Mass spectroscopic characterization of the coronavirus infectious bronchitis virus nucleoprotein and elucidation of the role of phosphorylation in RNA binding by using surface plasmon resonance</article-title>. <source>J. Virol.</source> <volume>79</volume> (<issue>2</issue>), <fpage>1164</fpage>&#x2013;<lpage>1179</lpage>. <pub-id pub-id-type="doi">10.1128/jvi.79.2.1164-1179.2005</pub-id>
</citation>
</ref>
<ref id="B29">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Chong</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Mir</surname>
<given-names>M.</given-names>
</name>
</person-group> (<year>2021</year>). <article-title>Towards decoding the sequence-based grammar governing the functions of intrinsically disordered protein regions</article-title>. <source>J. Mol. Biol.</source> <volume>433</volume> (<issue>12</issue>), <fpage>166724</fpage>. <pub-id pub-id-type="doi">10.1016/j.jmb.2020.11.023</pub-id>
</citation>
</ref>
<ref id="B30">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Clark</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Karsch-Mizrachi</surname>
<given-names>I.</given-names>
</name>
<name>
<surname>Lipman</surname>
<given-names>D.</given-names>
</name>
<name>
<surname>Ostell</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Sayers</surname>
<given-names>E. W.</given-names>
</name>
</person-group> (<year>2016</year>). <source>GenBank Nucleic Acids Res.</source> <volume>44</volume>, <fpage>D67</fpage>&#x2013;<lpage>D72</lpage>. <pub-id pub-id-type="doi">10.1093/nar/gkv1276</pub-id>
</citation>
</ref>
<ref id="B31">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Clark</surname>
<given-names>L. K.</given-names>
</name>
<name>
<surname>Green</surname>
<given-names>T. J.</given-names>
</name>
<name>
<surname>Petit</surname>
<given-names>C. M.</given-names>
</name>
</person-group> (<year>2021</year>). <article-title>Structure of nonstructural protein 1 from SARS-CoV-2</article-title>. <source>J. Virol.</source> <volume>95</volume> (<issue>4</issue>), <fpage>e02019-20</fpage>. <pub-id pub-id-type="doi">10.1128/jvi.02019-20</pub-id>
</citation>
</ref>
<ref id="B32">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Cong</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Kriegenburg</surname>
<given-names>F.</given-names>
</name>
<name>
<surname>de Haan</surname>
<given-names>C. A.</given-names>
</name>
<name>
<surname>Reggiori</surname>
<given-names>F.</given-names>
</name>
</person-group> (<year>2017</year>). <article-title>Coronavirus nucleocapsid proteins assemble constitutively in high molecular oligomers</article-title>. <source>Sci. Rep.</source> <volume>7</volume> (<issue>1</issue>), <fpage>5740</fpage>. <pub-id pub-id-type="doi">10.1038/s41598-017-06062-w</pub-id>
</citation>
</ref>
<ref id="B33">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Cubuk</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Alston</surname>
<given-names>J. J.</given-names>
</name>
<name>
<surname>Incicco</surname>
<given-names>J. J.</given-names>
</name>
<name>
<surname>Singh</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Stuchell-Brereton</surname>
<given-names>M. D.</given-names>
</name>
<name>
<surname>Ward</surname>
<given-names>M. D.</given-names>
</name>
<etal/>
</person-group> (<year>2021</year>). <article-title>The SARS-CoV-2 nucleocapsid protein is dynamic, disordered, and phase separates with RNA</article-title>. <source>Nat. Commun.</source> <volume>12</volume> (<issue>1</issue>), <fpage>1936</fpage>. <pub-id pub-id-type="doi">10.1038/s41467-021-21953-3</pub-id>
</citation>
</ref>
<ref id="B34">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Cui</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Wang</surname>
<given-names>H.</given-names>
</name>
<name>
<surname>Ji</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Yang</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Xu</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Huang</surname>
<given-names>X.</given-names>
</name>
<etal/>
</person-group> (<year>2015</year>). <article-title>The nucleocapsid protein of coronaviruses acts as a viral suppressor of RNA silencing in mammalian cells</article-title>. <source>J. Virol.</source> <volume>89</volume> (<issue>17</issue>), <fpage>9029</fpage>&#x2013;<lpage>9043</lpage>. <pub-id pub-id-type="doi">10.1128/jvi.01331-15</pub-id>
</citation>
</ref>
<ref id="B35">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Darling</surname>
<given-names>A. L.</given-names>
</name>
<name>
<surname>Uversky</surname>
<given-names>V. N.</given-names>
</name>
</person-group> (<year>2018</year>). <article-title>Intrinsic disorder and posttranslational modifications: the darker side of the biological dark matter</article-title>. <source>Front. Genet.</source> <volume>9</volume>, <fpage>158</fpage>. <pub-id pub-id-type="doi">10.3389/fgene.2018.00158</pub-id>
</citation>
</ref>
<ref id="B36">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Das</surname>
<given-names>R. K.</given-names>
</name>
<name>
<surname>Ruff</surname>
<given-names>K. M.</given-names>
</name>
<name>
<surname>Pappu</surname>
<given-names>R. V.</given-names>
</name>
</person-group> (<year>2015</year>). <article-title>Relating sequence encoded information to form and function of intrinsically disordered proteins</article-title>. <source>Curr. Opin. Struct. Biol.</source> <volume>32</volume>, <fpage>102</fpage>&#x2013;<lpage>112</lpage>. <pub-id pub-id-type="doi">10.1016/j.sbi.2015.03.008</pub-id>
</citation>
</ref>
<ref id="B37">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Davey</surname>
<given-names>N. E.</given-names>
</name>
<name>
<surname>Trav&#xe9;</surname>
<given-names>G.</given-names>
</name>
<name>
<surname>Gibson</surname>
<given-names>T. J.</given-names>
</name>
</person-group> (<year>2011</year>). <article-title>How viruses hijack cell regulation</article-title>. <source>Trends Biochem. Sci.</source> <volume>36</volume> (<issue>3</issue>), <fpage>159</fpage>&#x2013;<lpage>169</lpage>. <pub-id pub-id-type="doi">10.1016/j.tibs.2010.10.002</pub-id>
</citation>
</ref>
<ref id="B38">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Davidson</surname>
<given-names>A. D.</given-names>
</name>
<name>
<surname>Williamson</surname>
<given-names>M. K.</given-names>
</name>
<name>
<surname>Lewis</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Shoemark</surname>
<given-names>D.</given-names>
</name>
<name>
<surname>Carroll</surname>
<given-names>M. W.</given-names>
</name>
<name>
<surname>Heesom</surname>
<given-names>K. J.</given-names>
</name>
<etal/>
</person-group> (<year>2020</year>). <article-title>Characterisation of the transcriptome and proteome of SARS-CoV-2 reveals a cell passage induced in-frame deletion of the furin-like cleavage site from the spike glycoprotein</article-title>. <source>Genome Med.</source> <volume>12</volume> (<issue>1</issue>), <fpage>68</fpage>. <pub-id pub-id-type="doi">10.1186/s13073-020-00763-0</pub-id>
</citation>
</ref>
<ref id="B39">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Del</surname>
<given-names>V. S.</given-names>
</name>
<name>
<surname>Rivera</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Bustos</surname>
<given-names>D. M.</given-names>
</name>
<name>
<surname>Uhart</surname>
<given-names>M.</given-names>
</name>
</person-group> (<year>2021</year>). <article-title>Analysis of SARS-CoV-2 nucleocapsid phosphoprotein N variations in the binding site to human 14-3-3 proteins</article-title>. <source>Biochem. Biophys. Res. Commun.</source> <volume>569</volume>, <fpage>154</fpage>&#x2013;<lpage>160</lpage>. <pub-id pub-id-type="doi">10.1016/j.bbrc.2021.06.100</pub-id>
</citation>
</ref>
<ref id="B40">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Dokainish</surname>
<given-names>H. M.</given-names>
</name>
<name>
<surname>Sugita</surname>
<given-names>Y.</given-names>
</name>
</person-group> (<year>2023</year>). <article-title>Structural effects of spike protein D614G mutation in SARS-CoV-2</article-title>. <source>Biophysical J.</source> <volume>122</volume> (<issue>14</issue>), <fpage>2910</fpage>&#x2013;<lpage>2920</lpage>. <pub-id pub-id-type="doi">10.1016/j.bpj.2022.11.025</pub-id>
</citation>
</ref>
<ref id="B41">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Dunker</surname>
<given-names>A. K.</given-names>
</name>
<name>
<surname>Lawson</surname>
<given-names>J. D.</given-names>
</name>
<name>
<surname>Brown</surname>
<given-names>C. J.</given-names>
</name>
<name>
<surname>Williams</surname>
<given-names>R. M.</given-names>
</name>
<name>
<surname>Romero</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Oh</surname>
<given-names>J. S.</given-names>
</name>
<etal/>
</person-group> (<year>2001</year>). <article-title>Intrinsically disordered protein</article-title>. <source>J. Mol. Graph. Model.</source> <volume>19</volume> (<issue>1</issue>), <fpage>26</fpage>&#x2013;<lpage>59</lpage>. <pub-id pub-id-type="doi">10.1016/s1093-3263(00)00138-8</pub-id>
</citation>
</ref>
<ref id="B42">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Dyson</surname>
<given-names>H. J.</given-names>
</name>
<name>
<surname>Wright</surname>
<given-names>P. E.</given-names>
</name>
</person-group> (<year>2005</year>). <article-title>Intrinsically unstructured proteins and their functions</article-title>. <source>Nat. Rev. Mol. Cell Biol.</source> <volume>6</volume> (<issue>3</issue>), <fpage>197</fpage>&#x2013;<lpage>208</lpage>. <pub-id pub-id-type="doi">10.1038/nrm1589</pub-id>
</citation>
</ref>
<ref id="B43">
<citation citation-type="book">
<person-group person-group-type="author">
<name>
<surname>Dyson</surname>
<given-names>H. J.</given-names>
</name>
<name>
<surname>Wright</surname>
<given-names>P. E.</given-names>
</name>
</person-group> (<year>2018</year>). <article-title>How do intrinsically disordered viral proteins hijack the cell?</article-title> <source>Biochemistry</source>, <volume>57</volume> (<issue>28</issue>), <fpage>4045</fpage>&#x2013;<lpage>4046</lpage>. <pub-id pub-id-type="doi">10.1021/acs.biochem.8b00622</pub-id>
</citation>
</ref>
<ref id="B44">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>El-Maradny</surname>
<given-names>Y. A.</given-names>
</name>
<name>
<surname>Badawy</surname>
<given-names>M. A.</given-names>
</name>
<name>
<surname>Mohamed</surname>
<given-names>K. I.</given-names>
</name>
<name>
<surname>Ragab</surname>
<given-names>R. F.</given-names>
</name>
<name>
<surname>Moharm</surname>
<given-names>H. M.</given-names>
</name>
<name>
<surname>Abdallah</surname>
<given-names>N. A.</given-names>
</name>
<etal/>
</person-group> (<year>2024</year>). <article-title>Unraveling the role of the nucleocapsid protein in SARS-CoV-2 pathogenesis: from viral life cycle to vaccine development</article-title>. <source>Int. J. Biol. Macromol.</source> <volume>279</volume>, <fpage>135201</fpage>. <pub-id pub-id-type="doi">10.1016/j.ijbiomac.2024.135201</pub-id>
</citation>
</ref>
<ref id="B45">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Enjuanes</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Almaz&#xe1;n</surname>
<given-names>F.</given-names>
</name>
<name>
<surname>Sola</surname>
<given-names>I.</given-names>
</name>
<name>
<surname>Zu&#xf1;iga</surname>
<given-names>S.</given-names>
</name>
</person-group> (<year>2006</year>). <article-title>Biochemical aspects of coronavirus replication and virus-host interaction</article-title>. <source>Annu. Rev. Microbiol.</source> <volume>60</volume> (<issue>1</issue>), <fpage>211</fpage>&#x2013;<lpage>230</lpage>. <pub-id pub-id-type="doi">10.1146/annurev.micro.60.080805.142157</pub-id>
</citation>
</ref>
<ref id="B46">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Fang</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Liu</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Shen</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Lu</surname>
<given-names>A. Z.</given-names>
</name>
<name>
<surname>Wang</surname>
<given-names>A. K.</given-names>
</name>
<name>
<surname>Zhang</surname>
<given-names>Y.</given-names>
</name>
<etal/>
</person-group> (<year>2021</year>). <article-title>Updated SARS&#x2010;CoV&#x2010;2 single nucleotide variants and mortality association</article-title>. <source>J. Med. Virol.</source> <volume>93</volume> (<issue>12</issue>), <fpage>6525</fpage>&#x2013;<lpage>6534</lpage>. <pub-id pub-id-type="doi">10.1002/jmv.27191</pub-id>
</citation>
</ref>
<ref id="B47">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Feng</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Yi</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Yang</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Wang</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Wen</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Zhao</surname>
<given-names>W.</given-names>
</name>
<etal/>
</person-group> (<year>2024</year>). <article-title>COV2Var, a function annotation database of SARS-CoV-2 genetic variation</article-title>. <source>Nucleic acids Res.</source> <volume>52</volume> (<issue>D1</issue>), <fpage>D701</fpage>&#x2013;<lpage>D713</lpage>. <pub-id pub-id-type="doi">10.1093/nar/gkad958</pub-id>
</citation>
</ref>
<ref id="B48">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Freiberger</surname>
<given-names>M. I.</given-names>
</name>
<name>
<surname>Wolynes</surname>
<given-names>P. G.</given-names>
</name>
<name>
<surname>Ferreiro</surname>
<given-names>D. U.</given-names>
</name>
<name>
<surname>Fuxreiter</surname>
<given-names>M.</given-names>
</name>
</person-group> (<year>2021</year>). <article-title>Frustration in fuzzy protein complexes leads to interaction versatility</article-title>. <source>J. Phys. Chem. B</source> <volume>125</volume> (<issue>10</issue>), <fpage>2513</fpage>&#x2013;<lpage>2520</lpage>. <pub-id pub-id-type="doi">10.1021/acs.jpcb.0c11068</pub-id>
</citation>
</ref>
<ref id="B49">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Frolov</surname>
<given-names>I.</given-names>
</name>
<name>
<surname>Agback</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>Palchevska</surname>
<given-names>O.</given-names>
</name>
<name>
<surname>Dominguez</surname>
<given-names>F.</given-names>
</name>
<name>
<surname>Lomzov</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Agback</surname>
<given-names>P.</given-names>
</name>
<etal/>
</person-group> (<year>2023</year>). <article-title>All domains of SARS-CoV-2 nsp1 determine translational shutoff and cytotoxicity of the protein</article-title>. <source>J. Virol.</source> <volume>97</volume> (<issue>3</issue>), <fpage>e01865-22</fpage>. <pub-id pub-id-type="doi">10.1128/jvi.01865-22</pub-id>
</citation>
</ref>
<ref id="B50">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Gadhave</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Kumar</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Kumar</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Bhardwaj</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>Garg</surname>
<given-names>N.</given-names>
</name>
<name>
<surname>Giri</surname>
<given-names>R.</given-names>
</name>
</person-group> (<year>2021</year>). <article-title>Conformational dynamics of 13 amino acids long NSP11 of SARS-CoV-2 under membrane mimetics and different solvent conditions</article-title>. <source>Microb. Pathog.</source> <volume>158</volume>, <fpage>105041</fpage>. <pub-id pub-id-type="doi">10.1016/j.micpath.2021.105041</pub-id>
</citation>
</ref>
<ref id="B51">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Gianni</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Freiberger</surname>
<given-names>M. I.</given-names>
</name>
<name>
<surname>Jemth</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Ferreiro</surname>
<given-names>D. U.</given-names>
</name>
<name>
<surname>Wolynes</surname>
<given-names>P. G.</given-names>
</name>
<name>
<surname>Fuxreiter</surname>
<given-names>M.</given-names>
</name>
</person-group> (<year>2021</year>). <article-title>Fuzziness and frustration in the energy landscape of protein folding, function, and assembly</article-title>. <source>Accounts Chem. Res.</source> <volume>54</volume> (<issue>5</issue>), <fpage>1251</fpage>&#x2013;<lpage>1259</lpage>. <pub-id pub-id-type="doi">10.1021/acs.accounts.0c00813</pub-id>
</citation>
</ref>
<ref id="B52">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Giri</surname>
<given-names>R.</given-names>
</name>
<name>
<surname>Bhardwaj</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>Shegane</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Gehi</surname>
<given-names>B. R.</given-names>
</name>
<name>
<surname>Kumar</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Gadhave</surname>
<given-names>K.</given-names>
</name>
<etal/>
</person-group> (<year>2021</year>). <article-title>Understanding COVID-19 via comparative analysis of dark proteomes of SARS-CoV-2, human SARS and bat SARS-like coronaviruses</article-title>. <source>Cell Mol. Life Sci.</source> <volume>78</volume> (<issue>4</issue>), <fpage>1655</fpage>&#x2013;<lpage>1688</lpage>. <pub-id pub-id-type="doi">10.1007/s00018-020-03603-x</pub-id>
</citation>
</ref>
<ref id="B53">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Gitlin</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Hagai</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>LaBarbera</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Solovey</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Andino</surname>
<given-names>R.</given-names>
</name>
</person-group> (<year>2014</year>). <article-title>Rapid evolution of virus sequences in intrinsically disordered protein regions</article-title>. <source>PLoS Pathog.</source> <volume>10</volume> (<issue>12</issue>), <fpage>e1004529</fpage>. <pub-id pub-id-type="doi">10.1371/journal.ppat.1004529</pub-id>
</citation>
</ref>
<ref id="B54">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Goh</surname>
<given-names>G. K.-M.</given-names>
</name>
<name>
<surname>Dunker</surname>
<given-names>A. K.</given-names>
</name>
<name>
<surname>Foster</surname>
<given-names>J. A.</given-names>
</name>
<name>
<surname>Uversky</surname>
<given-names>V. N.</given-names>
</name>
</person-group> (<year>2020</year>). <article-title>Rigidity of the outer shell predicted by a protein intrinsic disorder model sheds light on the COVID-19 (Wuhan-2019-nCoV) infectivity</article-title>. <source>Biomolecules</source> <volume>10</volume> (<issue>2</issue>), <fpage>331</fpage>. <pub-id pub-id-type="doi">10.3390/biom10020331</pub-id>
</citation>
</ref>
<ref id="B55">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Goh</surname>
<given-names>G. K.-M.</given-names>
</name>
<name>
<surname>Dunker</surname>
<given-names>A. K.</given-names>
</name>
<name>
<surname>Uversky</surname>
<given-names>V.</given-names>
</name>
</person-group> (<year>2013</year>). <article-title>Prediction of intrinsic disorder in MERS-CoV/HCoV-EMC supports a high oral-fecal transmission</article-title>. <source>PLoS Curr.</source> <volume>5</volume>. <pub-id pub-id-type="doi">10.1371/currents.outbreaks.22254b58675cdebc256dbe3c5aa6498b</pub-id>
</citation>
</ref>
<ref id="B56">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Gomari</surname>
<given-names>M. M.</given-names>
</name>
<name>
<surname>Tarighi</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Choupani</surname>
<given-names>E.</given-names>
</name>
<name>
<surname>Abkhiz</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Mohamadzadeh</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Rostami</surname>
<given-names>N.</given-names>
</name>
<etal/>
</person-group> (<year>2023</year>). <article-title>Structural evolution of Delta lineage of SARS-CoV-2</article-title>. <source>Int. J. Biol. Macromol.</source> <volume>226</volume>, <fpage>1116</fpage>&#x2013;<lpage>1140</lpage>. <pub-id pub-id-type="doi">10.1016/j.ijbiomac.2022.11.227</pub-id>
</citation>
</ref>
<ref id="B57">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Gordon</surname>
<given-names>D. E.</given-names>
</name>
<name>
<surname>Jang</surname>
<given-names>G. M.</given-names>
</name>
<name>
<surname>Bouhaddou</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Xu</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Obernier</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>White</surname>
<given-names>K. M.</given-names>
</name>
<etal/>
</person-group> (<year>2020</year>). <article-title>A SARS-CoV-2 protein interaction map reveals targets for drug repurposing</article-title>. <source>Nature</source> <volume>583</volume> (<issue>7816</issue>), <fpage>459</fpage>&#x2013;<lpage>468</lpage>. <pub-id pub-id-type="doi">10.1038/s41586-020-2286-9</pub-id>
</citation>
</ref>
<ref id="B58">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Grossoehme</surname>
<given-names>N. E.</given-names>
</name>
<name>
<surname>Li</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Keane</surname>
<given-names>S. C.</given-names>
</name>
<name>
<surname>Liu</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Dann</surname>
<given-names>I. I. I. C. E.</given-names>
</name>
<name>
<surname>Leibowitz</surname>
<given-names>J. L.</given-names>
</name>
<etal/>
</person-group> (<year>2009</year>). <article-title>Coronavirus N protein N-terminal domain (NTD) specifically binds the transcriptional regulatory sequence (TRS) and melts TRS-cTRS RNA duplexes</article-title>. <source>J. Mol. Biol.</source> <volume>394</volume> (<issue>3</issue>), <fpage>544</fpage>&#x2013;<lpage>557</lpage>. <pub-id pub-id-type="doi">10.1016/j.jmb.2009.09.040</pub-id>
</citation>
</ref>
<ref id="B59">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Gupta</surname>
<given-names>M. N.</given-names>
</name>
<name>
<surname>Uversky</surname>
<given-names>V. N.</given-names>
</name>
</person-group> (<year>2024</year>). <article-title>Protein structure&#x2013;function continuum model: emerging nexuses between specificity, evolution, and structure</article-title>. <source>Protein Sci.</source> <volume>33</volume> (<issue>4</issue>), <fpage>e4968</fpage>. <pub-id pub-id-type="doi">10.1002/pro.4968</pub-id>
</citation>
</ref>
<ref id="B60">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Gypas</surname>
<given-names>F.</given-names>
</name>
<name>
<surname>Tsaousis</surname>
<given-names>G. N.</given-names>
</name>
<name>
<surname>Hamodrakas</surname>
<given-names>S. J.</given-names>
</name>
</person-group> (<year>2013</year>). <article-title>mpMoRFsDB: a database of molecular recognition features in membrane proteins</article-title>. <source>Bioinforma. Oxf. Engl.</source> <volume>29</volume> (<issue>19</issue>), <fpage>2517</fpage>&#x2013;<lpage>2518</lpage>. <pub-id pub-id-type="doi">10.1093/bioinformatics/btt427</pub-id>
</citation>
</ref>
<ref id="B61">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Haque</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Khatoon</surname>
<given-names>F.</given-names>
</name>
<name>
<surname>Ashgar</surname>
<given-names>S. S.</given-names>
</name>
<name>
<surname>Faidah</surname>
<given-names>H.</given-names>
</name>
<name>
<surname>Bantun</surname>
<given-names>F.</given-names>
</name>
<name>
<surname>Jalal</surname>
<given-names>N. A.</given-names>
</name>
<etal/>
</person-group> (<year>2023</year>). <article-title>Energetic and frustration analysis of SARS-CoV-2 nucleocapsid protein mutations</article-title>. <source>Biotechnol. Genet. Eng. Rev.</source> <volume>39</volume>, <fpage>1234</fpage>&#x2013;<lpage>1254</lpage>. <pub-id pub-id-type="doi">10.1080/02648725.2023.2170031</pub-id>
</citation>
</ref>
<ref id="B62">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Hassan</surname>
<given-names>S. S.</given-names>
</name>
<name>
<surname>Lundstrom</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Serrano-Aroca</surname>
<given-names>&#xc1;.</given-names>
</name>
<name>
<surname>Adadi</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Aljabali</surname>
<given-names>A. A. A.</given-names>
</name>
<name>
<surname>Redwan</surname>
<given-names>E. M.</given-names>
</name>
<etal/>
</person-group> (<year>2022</year>). <article-title>Emergence of unique SARS-CoV-2 ORF10 variants and their impact on protein structure and function</article-title>. <source>Int. J. Biol. Macromol.</source> <volume>194</volume>, <fpage>128</fpage>&#x2013;<lpage>143</lpage>. <pub-id pub-id-type="doi">10.1016/j.ijbiomac.2021.11.151</pub-id>
</citation>
</ref>
<ref id="B63">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>He</surname>
<given-names>R.</given-names>
</name>
<name>
<surname>Dobie</surname>
<given-names>F.</given-names>
</name>
<name>
<surname>Ballantine</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Leeson</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Li</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Bastien</surname>
<given-names>N.</given-names>
</name>
<etal/>
</person-group> (<year>2004</year>). <article-title>Analysis of multimerization of the SARS coronavirus nucleocapsid protein</article-title>. <source>Biochem. Biophys. Res. Commun.</source> <volume>316</volume> (<issue>2</issue>), <fpage>476</fpage>&#x2013;<lpage>483</lpage>. <pub-id pub-id-type="doi">10.1016/j.bbrc.2004.02.074</pub-id>
</citation>
</ref>
<ref id="B64">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Hsin</surname>
<given-names>W.-C.</given-names>
</name>
<name>
<surname>Chang</surname>
<given-names>C.-H.</given-names>
</name>
<name>
<surname>Chang</surname>
<given-names>C.-Y.</given-names>
</name>
<name>
<surname>Peng</surname>
<given-names>W.-H.</given-names>
</name>
<name>
<surname>Chien</surname>
<given-names>C.-L.</given-names>
</name>
<name>
<surname>Chang</surname>
<given-names>M.-F.</given-names>
</name>
<etal/>
</person-group> (<year>2018</year>). <article-title>Nucleocapsid protein-dependent assembly of the RNA packaging signal of Middle East respiratory syndrome coronavirus</article-title>. <source>J. Biomed. Sci.</source> <volume>25</volume> (<issue>1</issue>), <fpage>47</fpage>. <pub-id pub-id-type="doi">10.1186/s12929-018-0449-x</pub-id>
</citation>
</ref>
<ref id="B65">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Huang</surname>
<given-names>C.</given-names>
</name>
<name>
<surname>Lokugamage</surname>
<given-names>K. G.</given-names>
</name>
<name>
<surname>Rozovics</surname>
<given-names>J. M.</given-names>
</name>
<name>
<surname>Narayanan</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Semler</surname>
<given-names>B. L.</given-names>
</name>
<name>
<surname>Makino</surname>
<given-names>S.</given-names>
</name>
</person-group> (<year>2011</year>). <article-title>SARS coronavirus nsp1 protein induces template-dependent endonucleolytic cleavage of mRNAs: viral mRNAs are resistant to nsp1-induced RNA cleavage</article-title>. <source>PLoS Pathog.</source> <volume>7</volume> (<issue>12</issue>), <fpage>e1002433</fpage>. <pub-id pub-id-type="doi">10.1371/journal.ppat.1002433</pub-id>
</citation>
</ref>
<ref id="B66">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Huang</surname>
<given-names>Q.</given-names>
</name>
<name>
<surname>Yu</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Petros</surname>
<given-names>A. M.</given-names>
</name>
<name>
<surname>Gunasekera</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Liu</surname>
<given-names>Z.</given-names>
</name>
<name>
<surname>Xu</surname>
<given-names>N.</given-names>
</name>
<etal/>
</person-group> (<year>2004</year>). <article-title>Structure of the N-terminal RNA-binding domain of the SARS CoV nucleocapsid protein</article-title>. <source>Biochemistry</source> <volume>43</volume> (<issue>20</issue>), <fpage>6059</fpage>&#x2013;<lpage>6063</lpage>. <pub-id pub-id-type="doi">10.1021/bi036155b</pub-id>
</citation>
</ref>
<ref id="B67">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Huang</surname>
<given-names>W.</given-names>
</name>
<name>
<surname>Ju</surname>
<given-names>X.</given-names>
</name>
<name>
<surname>Tian</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Li</surname>
<given-names>X.</given-names>
</name>
<name>
<surname>Yu</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Sun</surname>
<given-names>Q.</given-names>
</name>
<etal/>
</person-group> (<year>2021</year>). <article-title>Molecular determinants for regulation of G3BP1/2 phase separation by the SARS-CoV-2 nucleocapsid protein</article-title>. <source>Cell Discov.</source> <volume>7</volume> (<issue>1</issue>), <fpage>69</fpage>. <pub-id pub-id-type="doi">10.1038/s41421-021-00306-w</pub-id>
</citation>
</ref>
<ref id="B68">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Iakoucheva</surname>
<given-names>L. M.</given-names>
</name>
<name>
<surname>Brown</surname>
<given-names>C. J.</given-names>
</name>
<name>
<surname>Lawson</surname>
<given-names>J. D.</given-names>
</name>
<name>
<surname>Obradovi&#x107;</surname>
<given-names>Z.</given-names>
</name>
<name>
<surname>Dunker</surname>
<given-names>A. K.</given-names>
</name>
</person-group> (<year>2002</year>). <article-title>Intrinsic disorder in cell-signaling and cancer-associated proteins</article-title>. <source>J. Mol. Biol.</source> <volume>323</volume> (<issue>3</issue>), <fpage>573</fpage>&#x2013;<lpage>584</lpage>. <pub-id pub-id-type="doi">10.1016/s0022-2836(02)00969-5</pub-id>
</citation>
</ref>
<ref id="B69">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Ilyas</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Manan</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Lee</surname>
<given-names>D.</given-names>
</name>
</person-group> (<year>2025</year>). <article-title>Deep learning-based comparative prediction and functional analysis of intrinsically disordered regions in SARS-CoV-2</article-title>. <source>Int. J. Mol. Sci.</source> <volume>26</volume> (<issue>7</issue>), <fpage>3411</fpage>. <pub-id pub-id-type="doi">10.3390/ijms26073411</pub-id>
</citation>
</ref>
<ref id="B70">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Iserman</surname>
<given-names>C.</given-names>
</name>
<name>
<surname>Roden</surname>
<given-names>C. A.</given-names>
</name>
<name>
<surname>Boerneke</surname>
<given-names>M. A.</given-names>
</name>
<name>
<surname>Sealfon</surname>
<given-names>R. S. G.</given-names>
</name>
<name>
<surname>McLaughlin</surname>
<given-names>G. A.</given-names>
</name>
<name>
<surname>Jungreis</surname>
<given-names>I.</given-names>
</name>
<etal/>
</person-group> (<year>2020</year>). <article-title>Genomic RNA elements drive phase separation of the SARS-CoV-2 nucleocapsid</article-title>. <source>Mol. Cell</source> <volume>80</volume> (<issue>6</issue>), <fpage>1078</fpage>&#x2013;<lpage>91.e6</lpage>. <pub-id pub-id-type="doi">10.1016/j.molcel.2020.11.041</pub-id>
</citation>
</ref>
<ref id="B71">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Jayaram</surname>
<given-names>H.</given-names>
</name>
<name>
<surname>Fan</surname>
<given-names>H.</given-names>
</name>
<name>
<surname>Bowman</surname>
<given-names>B. R.</given-names>
</name>
<name>
<surname>Ooi</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Jayaram</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Collisson</surname>
<given-names>E. W.</given-names>
</name>
<etal/>
</person-group> (<year>2006</year>). <article-title>X-ray structures of the N-and C-terminal domains of a coronavirus nucleocapsid protein: implications for nucleocapsid formation</article-title>. <source>J. Virol.</source> <volume>80</volume> (<issue>13</issue>), <fpage>6612</fpage>&#x2013;<lpage>6620</lpage>. <pub-id pub-id-type="doi">10.1128/jvi.00157-06</pub-id>
</citation>
</ref>
<ref id="B72">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Jia</surname>
<given-names>Z.</given-names>
</name>
<name>
<surname>Liu</surname>
<given-names>C.</given-names>
</name>
<name>
<surname>Chen</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Jiang</surname>
<given-names>H.</given-names>
</name>
<name>
<surname>Wang</surname>
<given-names>Z.</given-names>
</name>
<name>
<surname>Yao</surname>
<given-names>J.</given-names>
</name>
<etal/>
</person-group> (<year>2022</year>). <article-title>Crystal structures of the SARS&#x2010;CoV&#x2010;2 nucleocapsid protein C&#x2010;terminal domain and development of nucleocapsid&#x2010;targeting nanobodies</article-title>. <source>FEBS J.</source> <volume>289</volume> (<issue>13</issue>), <fpage>3813</fpage>&#x2013;<lpage>3825</lpage>. <pub-id pub-id-type="doi">10.1111/febs.16239</pub-id>
</citation>
</ref>
<ref id="B73">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Jin</surname>
<given-names>F.</given-names>
</name>
<name>
<surname>Gr&#xe4;ter</surname>
<given-names>F.</given-names>
</name>
</person-group> (<year>2021</year>). <article-title>How multisite phosphorylation impacts the conformations of intrinsically disordered proteins</article-title>. <source>PLoS Comput. Biol.</source> <volume>17</volume> (<issue>5</issue>), <fpage>e1008939</fpage>. <pub-id pub-id-type="doi">10.1371/journal.pcbi.1008939</pub-id>
</citation>
</ref>
<ref id="B74">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Johnson</surname>
<given-names>B. A.</given-names>
</name>
<name>
<surname>Zhou</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Lokugamage</surname>
<given-names>K. G.</given-names>
</name>
<name>
<surname>Vu</surname>
<given-names>M. N.</given-names>
</name>
<name>
<surname>Bopp</surname>
<given-names>N.</given-names>
</name>
<name>
<surname>Crocquet-Valdes</surname>
<given-names>P. A.</given-names>
</name>
<etal/>
</person-group> (<year>2022</year>). <article-title>Nucleocapsid mutations in SARS-CoV-2 augment replication and pathogenesis</article-title>. <source>PLoS Pathog.</source> <volume>18</volume> (<issue>6</issue>), <fpage>e1010627</fpage>. <pub-id pub-id-type="doi">10.1371/journal.ppat.1010627</pub-id>
</citation>
</ref>
<ref id="B75">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Ju</surname>
<given-names>X.</given-names>
</name>
<name>
<surname>Zhu</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Wang</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Li</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Zhang</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Gong</surname>
<given-names>M.</given-names>
</name>
<etal/>
</person-group> (<year>2021</year>). <article-title>A novel cell culture system modeling the SARS-CoV-2 life cycle</article-title>. <source>PLoS Pathog.</source> <volume>17</volume> (<issue>3</issue>), <fpage>e1009439</fpage>. <pub-id pub-id-type="doi">10.1371/journal.ppat.1009439</pub-id>
</citation>
</ref>
<ref id="B76">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Kamitani</surname>
<given-names>W.</given-names>
</name>
<name>
<surname>Huang</surname>
<given-names>C.</given-names>
</name>
<name>
<surname>Narayanan</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Lokugamage</surname>
<given-names>K. G.</given-names>
</name>
<name>
<surname>Makino</surname>
<given-names>S.</given-names>
</name>
</person-group> (<year>2009</year>). <article-title>A two-pronged strategy to suppress host protein synthesis by SARS coronavirus Nsp1 protein</article-title>. <source>Nat. Struct. Mol. Biol.</source> <volume>16</volume> (<issue>11</issue>), <fpage>1134</fpage>&#x2013;<lpage>1140</lpage>. <pub-id pub-id-type="doi">10.1038/nsmb.1680</pub-id>
</citation>
</ref>
<ref id="B77">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Kang</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Yang</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Hong</surname>
<given-names>Z.</given-names>
</name>
<name>
<surname>Zhang</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Huang</surname>
<given-names>Z.</given-names>
</name>
<name>
<surname>Chen</surname>
<given-names>X.</given-names>
</name>
<etal/>
</person-group> (<year>2020</year>). <article-title>Crystal structure of SARS-CoV-2 nucleocapsid protein RNA binding domain reveals potential unique drug targeting sites</article-title>. <source>Acta Pharm. Sin. B</source> <volume>10</volume> (<issue>7</issue>), <fpage>1228</fpage>&#x2013;<lpage>1238</lpage>. <pub-id pub-id-type="doi">10.1016/j.apsb.2020.04.009</pub-id>
</citation>
</ref>
<ref id="B78">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Kato</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Ikliptikawati</surname>
<given-names>D. K.</given-names>
</name>
<name>
<surname>Kobayashi</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Kondo</surname>
<given-names>H.</given-names>
</name>
<name>
<surname>Lim</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Hazawa</surname>
<given-names>M.</given-names>
</name>
<etal/>
</person-group> (<year>2021</year>). <article-title>Overexpression of SARS-CoV-2 protein ORF6 dislocates RAE1 and NUP98 from the nuclear pore complex</article-title>. <source>Biochem. Biophys. Res. Commun.</source> <volume>536</volume>, <fpage>59</fpage>&#x2013;<lpage>66</lpage>. <pub-id pub-id-type="doi">10.1016/j.bbrc.2020.11.115</pub-id>
</citation>
</ref>
<ref id="B79">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Keane</surname>
<given-names>S. C.</given-names>
</name>
<name>
<surname>Giedroc</surname>
<given-names>D. P.</given-names>
</name>
</person-group> (<year>2013</year>). <article-title>Solution structure of mouse hepatitis virus (MHV) nsp3a and determinants of the interaction with MHV nucleocapsid (N) protein</article-title>. <source>J. Virol.</source> <volume>87</volume> (<issue>6</issue>), <fpage>3502</fpage>&#x2013;<lpage>3515</lpage>. <pub-id pub-id-type="doi">10.1128/jvi.03112-12</pub-id>
</citation>
</ref>
<ref id="B80">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Kim</surname>
<given-names>D.</given-names>
</name>
<name>
<surname>Lee</surname>
<given-names>J.-Y.</given-names>
</name>
<name>
<surname>Yang</surname>
<given-names>J.-S.</given-names>
</name>
<name>
<surname>Kim</surname>
<given-names>J. W.</given-names>
</name>
<name>
<surname>Kim</surname>
<given-names>V. N.</given-names>
</name>
<name>
<surname>Chang</surname>
<given-names>H.</given-names>
</name>
</person-group> (<year>2020</year>). <article-title>The architecture of SARS-CoV-2 transcriptome</article-title>. <source>Cell</source> <volume>181</volume> (<issue>4</issue>), <fpage>914</fpage>&#x2013;<lpage>21. e10</lpage>. <pub-id pub-id-type="doi">10.1016/j.cell.2020.04.011</pub-id>
</citation>
</ref>
<ref id="B81">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Klein</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Cortese</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Winter</surname>
<given-names>S. L.</given-names>
</name>
<name>
<surname>Wachsmuth-Melm</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Neufeldt</surname>
<given-names>C. J.</given-names>
</name>
<name>
<surname>Cerikan</surname>
<given-names>B.</given-names>
</name>
<etal/>
</person-group> (<year>2020</year>). <article-title>SARS-CoV-2 structure and replication characterized by <italic>in situ</italic> cryo-electron tomography</article-title>. <source>Nat. Commun.</source> <volume>11</volume> (<issue>1</issue>), <fpage>5885</fpage>. <pub-id pub-id-type="doi">10.1038/s41467-020-19619-7</pub-id>
</citation>
</ref>
<ref id="B82">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Koh</surname>
<given-names>G. C.</given-names>
</name>
<name>
<surname>Porras</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Aranda</surname>
<given-names>B.</given-names>
</name>
<name>
<surname>Hermjakob</surname>
<given-names>H.</given-names>
</name>
<name>
<surname>Orchard</surname>
<given-names>S. E.</given-names>
</name>
</person-group> (<year>2012</year>). <article-title>Analyzing protein&#x2013;protein interaction networks</article-title>. <source>J. Proteome Res.</source> <volume>11</volume> (<issue>4</issue>), <fpage>2014</fpage>&#x2013;<lpage>2031</lpage>. <pub-id pub-id-type="doi">10.1021/pr201211w</pub-id>
</citation>
</ref>
<ref id="B83">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Kotta-Loizou</surname>
<given-names>I.</given-names>
</name>
<name>
<surname>Tsaousis</surname>
<given-names>G. N.</given-names>
</name>
<name>
<surname>Hamodrakas</surname>
<given-names>S. J.</given-names>
</name>
</person-group> (<year>2013</year>). <article-title>Analysis of molecular recognition features (MoRFs) in membrane proteins</article-title>. <source>Biochimica Biophysica Acta (BBA)-Proteins Proteomics.</source> <volume>1834</volume> (<issue>4</issue>), <fpage>798</fpage>&#x2013;<lpage>807</lpage>. <pub-id pub-id-type="doi">10.1016/j.bbapap.2013.01.006</pub-id>
</citation>
</ref>
<ref id="B84">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Kruse</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>Benz</surname>
<given-names>C.</given-names>
</name>
<name>
<surname>Garvanska</surname>
<given-names>D. H.</given-names>
</name>
<name>
<surname>Lindqvist</surname>
<given-names>R.</given-names>
</name>
<name>
<surname>Mihalic</surname>
<given-names>F.</given-names>
</name>
<name>
<surname>Coscia</surname>
<given-names>F.</given-names>
</name>
<etal/>
</person-group> (<year>2021</year>). <article-title>Large scale discovery of coronavirus-host factor protein interaction motifs reveals SARS-CoV-2 specific mechanisms and vulnerabilities</article-title>. <source>Nat. Commun.</source> <volume>12</volume> (<issue>1</issue>), <fpage>6761</fpage>. <pub-id pub-id-type="doi">10.1038/s41467-021-26498-z</pub-id>
</citation>
</ref>
<ref id="B85">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Kubinski</surname>
<given-names>H. C.</given-names>
</name>
<name>
<surname>Despres</surname>
<given-names>H. W.</given-names>
</name>
<name>
<surname>Johnson</surname>
<given-names>B. A.</given-names>
</name>
<name>
<surname>Schmidt</surname>
<given-names>M. M.</given-names>
</name>
<name>
<surname>Jaffrani</surname>
<given-names>S. A.</given-names>
</name>
<name>
<surname>Turner</surname>
<given-names>A. H.</given-names>
</name>
<etal/>
</person-group> (<year>2025</year>). <article-title>Variant mutation G215C in SARS-CoV-2 nucleocapsid enhances viral infection via altered genomic encapsidation</article-title>. <source>PLoS Biol.</source> <volume>23</volume> (<issue>4</issue>), <fpage>e3003115</fpage>. <pub-id pub-id-type="doi">10.1371/journal.pbio.3003115</pub-id>
</citation>
</ref>
<ref id="B86">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Kulkarni</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Porter</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Chou</surname>
<given-names>T.-F.</given-names>
</name>
<name>
<surname>Chong</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Chiti</surname>
<given-names>F.</given-names>
</name>
<name>
<surname>Schafer</surname>
<given-names>J. W.</given-names>
</name>
<etal/>
</person-group> (<year>2025</year>). <article-title>Evolving concepts of the protein universe</article-title>. <source>iScience</source> <volume>28</volume> (<issue>3</issue>), <fpage>112012</fpage>. <pub-id pub-id-type="doi">10.1016/j.isci.2025.112012</pub-id>
</citation>
</ref>
<ref id="B87">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Kumar</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Kumar</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Kumar</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Garg</surname>
<given-names>N.</given-names>
</name>
<name>
<surname>Giri</surname>
<given-names>R.</given-names>
</name>
</person-group> (<year>2021</year>). <article-title>SARS-CoV-2 NSP1 C-terminal (residues 131&#x2013;180) is an intrinsically disordered region in isolation</article-title>. <source>Curr. Res. Virological Sci.</source> <volume>2</volume>, <fpage>100007</fpage>. <pub-id pub-id-type="doi">10.1016/j.crviro.2021.100007</pub-id>
</citation>
</ref>
<ref id="B88">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Lan</surname>
<given-names>T. C.</given-names>
</name>
<name>
<surname>Allan</surname>
<given-names>M. F.</given-names>
</name>
<name>
<surname>Malsick</surname>
<given-names>L. E.</given-names>
</name>
<name>
<surname>Woo</surname>
<given-names>J. Z.</given-names>
</name>
<name>
<surname>Zhu</surname>
<given-names>C.</given-names>
</name>
<name>
<surname>Zhang</surname>
<given-names>F.</given-names>
</name>
<etal/>
</person-group> (<year>2022</year>). <article-title>Secondary structural ensembles of the SARS-CoV-2 RNA genome in infected cells</article-title>. <source>Nat. Commun.</source> <volume>13</volume> (<issue>1</issue>), <fpage>1128</fpage>. <pub-id pub-id-type="doi">10.1038/s41467-022-28603-2</pub-id>
</citation>
</ref>
<ref id="B89">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Leary</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Gaudieri</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Parker</surname>
<given-names>M. D.</given-names>
</name>
<name>
<surname>Chopra</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>James</surname>
<given-names>I.</given-names>
</name>
<name>
<surname>Pakala</surname>
<given-names>S.</given-names>
</name>
<etal/>
</person-group> (<year>2021</year>). <article-title>Generation of a novel SARS-CoV-2 sub-genomic RNA due to the R203K/G204R variant in nucleocapsid: homologous recombination has potential to change SARS-CoV-2 at both protein and RNA level</article-title>. <source>Pathogens Immun.</source> <volume>6</volume> (<issue>2</issue>), <fpage>27</fpage>&#x2013;<lpage>49</lpage>. <pub-id pub-id-type="doi">10.20411/pai.v6i2.460</pub-id>
</citation>
</ref>
<ref id="B90">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Lei</surname>
<given-names>X.</given-names>
</name>
<name>
<surname>Dong</surname>
<given-names>X.</given-names>
</name>
<name>
<surname>Ma</surname>
<given-names>R.</given-names>
</name>
<name>
<surname>Wang</surname>
<given-names>W.</given-names>
</name>
<name>
<surname>Xiao</surname>
<given-names>X.</given-names>
</name>
<name>
<surname>Tian</surname>
<given-names>Z.</given-names>
</name>
<etal/>
</person-group> (<year>2020</year>). <article-title>Activation and evasion of type I interferon responses by SARS-CoV-2</article-title>. <source>Nat. Commun.</source> <volume>11</volume> (<issue>1</issue>), <fpage>3810</fpage>. <pub-id pub-id-type="doi">10.1038/s41467-020-17665-9</pub-id>
</citation>
</ref>
<ref id="B91">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Li</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Guo</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Tian</surname>
<given-names>X.</given-names>
</name>
<name>
<surname>Wang</surname>
<given-names>X.</given-names>
</name>
<name>
<surname>Yang</surname>
<given-names>X.</given-names>
</name>
<name>
<surname>Wu</surname>
<given-names>P.</given-names>
</name>
<etal/>
</person-group> (<year>2021</year>). <article-title>Virus-host interactome and proteomic survey reveal potential virulence factors influencing SARS-CoV-2 pathogenesis</article-title>. <source>Med</source> <volume>2</volume> (<issue>1</issue>), <fpage>99</fpage>&#x2013;<lpage>112.e7</lpage>. <pub-id pub-id-type="doi">10.1016/j.medj.2020.07.002</pub-id>
</citation>
</ref>
<ref id="B92">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Li</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Yang</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Yang</surname>
<given-names>L. Q.</given-names>
</name>
</person-group> (<year>2024</year>). <article-title>Effects of intrinsically disordered regions in gp120 underlying HIV neutralization phenotypes</article-title>. <source>Biochem. biophysical Res. Commun.</source> <volume>709</volume>, <fpage>149830</fpage>. <pub-id pub-id-type="doi">10.1016/j.bbrc.2024.149830</pub-id>
</citation>
</ref>
<ref id="B93">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Lin</surname>
<given-names>Y.-H.</given-names>
</name>
<name>
<surname>Forman-Kay</surname>
<given-names>J. D.</given-names>
</name>
<name>
<surname>Chan</surname>
<given-names>H. S.</given-names>
</name>
</person-group> (<year>2018</year>). <article-title>Theories for sequence-dependent phase behaviors of biomolecular condensates</article-title>. <source>Biochemistry</source> <volume>57</volume> (<issue>17</issue>), <fpage>2499</fpage>&#x2013;<lpage>2508</lpage>. <pub-id pub-id-type="doi">10.1021/acs.biochem.8b00058</pub-id>
</citation>
</ref>
<ref id="B94">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Lindsay</surname>
<given-names>R. J.</given-names>
</name>
<name>
<surname>Mansbach</surname>
<given-names>R. A.</given-names>
</name>
<name>
<surname>Gnanakaran</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Shen</surname>
<given-names>T.</given-names>
</name>
</person-group> (<year>2021</year>). <article-title>Effects of pH on an IDP conformational ensemble explored by molecular dynamics simulation</article-title>. <source>Biophys. Chem.</source> <volume>271</volume>, <fpage>106552</fpage>. <pub-id pub-id-type="doi">10.1016/j.bpc.2021.106552</pub-id>
</citation>
</ref>
<ref id="B95">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Lokugamage</surname>
<given-names>K. G.</given-names>
</name>
<name>
<surname>Narayanan</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Huang</surname>
<given-names>C.</given-names>
</name>
<name>
<surname>Makino</surname>
<given-names>S.</given-names>
</name>
</person-group> (<year>2012</year>). <article-title>Severe acute respiratory syndrome coronavirus protein nsp1 is a novel eukaryotic translation inhibitor that represses multiple steps of translation initiation</article-title>. <source>J. Virol.</source> <volume>86</volume> (<issue>24</issue>), <fpage>13598</fpage>&#x2013;<lpage>13608</lpage>. <pub-id pub-id-type="doi">10.1128/jvi.01958-12</pub-id>
</citation>
</ref>
<ref id="B96">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Lu</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Ye</surname>
<given-names>Q.</given-names>
</name>
<name>
<surname>Singh</surname>
<given-names>D.</given-names>
</name>
<name>
<surname>Cao</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Diedrich</surname>
<given-names>J. K.</given-names>
</name>
<name>
<surname>Yates</surname>
<given-names>J. R.</given-names>
</name>
<etal/>
</person-group> (<year>2021</year>). <article-title>The SARS-CoV-2 nucleocapsid phosphoprotein forms mutually exclusive condensates with RNA and the membrane-associated M protein</article-title>. <source>Nat. Commun.</source> <volume>12</volume> (<issue>1</issue>), <fpage>502</fpage>. <pub-id pub-id-type="doi">10.1038/s41467-020-20768-y</pub-id>
</citation>
</ref>
<ref id="B97">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Luo</surname>
<given-names>H.</given-names>
</name>
<name>
<surname>Chen</surname>
<given-names>Q.</given-names>
</name>
<name>
<surname>Chen</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Chen</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Shen</surname>
<given-names>X.</given-names>
</name>
<name>
<surname>Jiang</surname>
<given-names>H.</given-names>
</name>
</person-group> (<year>2005</year>). <article-title>The nucleocapsid protein of SARS coronavirus has a high binding affinity to the human cellular heterogeneous nuclear ribonucleoprotein A1</article-title>. <source>FEBS Lett.</source> <volume>579</volume> (<issue>12</issue>), <fpage>2623</fpage>&#x2013;<lpage>2628</lpage>. <pub-id pub-id-type="doi">10.1016/j.febslet.2005.03.080</pub-id>
</citation>
</ref>
<ref id="B98">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Luo</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Li</surname>
<given-names>Z.</given-names>
</name>
<name>
<surname>Zhao</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>Ju</surname>
<given-names>X.</given-names>
</name>
<name>
<surname>Ma</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Jin</surname>
<given-names>B.</given-names>
</name>
<etal/>
</person-group> (<year>2021</year>). <article-title>SARS-CoV-2 nucleocapsid protein phase separates with G3BPs to disassemble stress granules and facilitate viral production</article-title>. <source>Sci. Bull.</source> <volume>66</volume> (<issue>12</issue>), <fpage>1194</fpage>&#x2013;<lpage>1204</lpage>. <pub-id pub-id-type="doi">10.1016/j.scib.2021.01.013</pub-id>
</citation>
</ref>
<ref id="B99">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Malone</surname>
<given-names>B.</given-names>
</name>
<name>
<surname>Urakova</surname>
<given-names>N.</given-names>
</name>
<name>
<surname>Snijder</surname>
<given-names>E. J.</given-names>
</name>
<name>
<surname>Campbell</surname>
<given-names>E. A.</given-names>
</name>
</person-group> (<year>2022</year>). <article-title>Structures and functions of coronavirus replication&#x2013;transcription complexes and their relevance for SARS-CoV-2 drug design</article-title>. <source>Nat. Rev. Mol. Cell Biol.</source> <volume>23</volume> (<issue>1</issue>), <fpage>21</fpage>&#x2013;<lpage>39</lpage>. <pub-id pub-id-type="doi">10.1038/s41580-021-00432-z</pub-id>
</citation>
</ref>
<ref id="B100">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Masters</surname>
<given-names>P. S.</given-names>
</name>
</person-group> (<year>2006</year>). <article-title>The molecular biology of coronaviruses</article-title>. <source>Adv. Virus Res.</source> <volume>66</volume>, <fpage>193</fpage>&#x2013;<lpage>292</lpage>. <pub-id pub-id-type="doi">10.1016/s0065-3527(06)66005-3</pub-id>
</citation>
</ref>
<ref id="B101">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>McBride</surname>
<given-names>R.</given-names>
</name>
<name>
<surname>Van Zyl</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Fielding</surname>
<given-names>B. C.</given-names>
</name>
</person-group> (<year>2014</year>). <article-title>The coronavirus nucleocapsid is a multifunctional protein</article-title>. <source>Viruses</source> <volume>6</volume> (<issue>8</issue>), <fpage>2991</fpage>&#x2013;<lpage>3018</lpage>. <pub-id pub-id-type="doi">10.3390/v6082991</pub-id>
</citation>
</ref>
<ref id="B102">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Medeiros-Silva</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Somberg</surname>
<given-names>N. H.</given-names>
</name>
<name>
<surname>Wang</surname>
<given-names>H. K.</given-names>
</name>
<name>
<surname>McKay</surname>
<given-names>M. J.</given-names>
</name>
<name>
<surname>Mandala</surname>
<given-names>V. S.</given-names>
</name>
<name>
<surname>Dregni</surname>
<given-names>A. J.</given-names>
</name>
<etal/>
</person-group> (<year>2022</year>). <article-title>pH-and calcium-dependent aromatic network in the SARS-CoV-2 envelope protein</article-title>. <source>J. Am. Chem. Soc.</source> <volume>144</volume> (<issue>15</issue>), <fpage>6839</fpage>&#x2013;<lpage>6850</lpage>. <pub-id pub-id-type="doi">10.1021/jacs.2c00973</pub-id>
</citation>
</ref>
<ref id="B103">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Mendez</surname>
<given-names>A. S.</given-names>
</name>
<name>
<surname>Ly</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Gonz&#xe1;lez-S&#xe1;nchez</surname>
<given-names>A. M.</given-names>
</name>
<name>
<surname>Hartenian</surname>
<given-names>E.</given-names>
</name>
<name>
<surname>Ingolia</surname>
<given-names>N. T.</given-names>
</name>
<name>
<surname>Cate</surname>
<given-names>J. H.</given-names>
</name>
<etal/>
</person-group> (<year>2021</year>). <article-title>The N-terminal domain of SARS-CoV-2 nsp1 plays key roles in suppression of cellular gene expression and preservation of viral gene expression</article-title>. <source>Cell Rep.</source> <volume>37</volume> (<issue>3</issue>), <fpage>109841</fpage>. <pub-id pub-id-type="doi">10.1016/j.celrep.2021.109841</pub-id>
</citation>
</ref>
<ref id="B104">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>M&#xe9;sz&#xe1;ros</surname>
<given-names>B.</given-names>
</name>
<name>
<surname>Erd&#x151;s</surname>
<given-names>G.</given-names>
</name>
<name>
<surname>Doszt&#xe1;nyi</surname>
<given-names>Z.</given-names>
</name>
</person-group> (<year>2018</year>). <article-title>IUPred2A: context-dependent prediction of protein disorder as a function of redox state and protein binding</article-title>. <source>Nucleic acids Res.</source> <volume>46</volume> (<issue>W1</issue>), <fpage>W329</fpage>&#x2013;<lpage>W337</lpage>. <pub-id pub-id-type="doi">10.1093/nar/gky384</pub-id>
</citation>
</ref>
<ref id="B105">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Michelitsch</surname>
<given-names>M. D.</given-names>
</name>
<name>
<surname>Weissman</surname>
<given-names>J. S.</given-names>
</name>
</person-group> (<year>2000</year>). <article-title>A census of glutamine/asparagine-rich regions: implications for their conserved function and the prediction of novel prions</article-title>. <source>Proc. Natl. Acad. Sci. U. S. A.</source> <volume>97</volume> (<issue>22</issue>), <fpage>11910</fpage>&#x2013;<lpage>11915</lpage>. <pub-id pub-id-type="doi">10.1073/pnas.97.22.11910</pub-id>
</citation>
</ref>
<ref id="B106">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Milorey</surname>
<given-names>B.</given-names>
</name>
<name>
<surname>Schweitzer-Stenner</surname>
<given-names>R.</given-names>
</name>
<name>
<surname>Andrews</surname>
<given-names>B.</given-names>
</name>
<name>
<surname>Schwalbe</surname>
<given-names>H.</given-names>
</name>
<name>
<surname>Urbanc</surname>
<given-names>B.</given-names>
</name>
</person-group> (<year>2021</year>). <article-title>Short peptides as predictors for the structure of polyarginine sequences in disordered proteins</article-title>. <source>Biophysical J.</source> <volume>120</volume> (<issue>4</issue>), <fpage>662</fpage>&#x2013;<lpage>676</lpage>. <pub-id pub-id-type="doi">10.1016/j.bpj.2020.12.026</pub-id>
</citation>
</ref>
<ref id="B107">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Miorin</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Kehrer</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>Sanchez-Aparicio</surname>
<given-names>M. T.</given-names>
</name>
<name>
<surname>Zhang</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Cohen</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Patel</surname>
<given-names>R. S.</given-names>
</name>
<etal/>
</person-group> (<year>2020</year>). <article-title>SARS-CoV-2 Orf6 hijacks Nup98 to block STAT nuclear import and antagonize interferon signaling</article-title>. <source>Proc. Natl. Acad. Sci. U. S. A.</source> <volume>117</volume> (<issue>45</issue>), <fpage>28344</fpage>&#x2013;<lpage>28354</lpage>. <pub-id pub-id-type="doi">10.1073/pnas.2016650117</pub-id>
</citation>
</ref>
<ref id="B108">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Mishra</surname>
<given-names>P. M.</given-names>
</name>
<name>
<surname>Uversky</surname>
<given-names>V. N.</given-names>
</name>
<name>
<surname>Giri</surname>
<given-names>R.</given-names>
</name>
</person-group> (<year>2018</year>). <article-title>Molecular recognition features in Zika virus proteome</article-title>. <source>J. Mol. Biol.</source> <volume>430</volume> (<issue>16</issue>), <fpage>2372</fpage>&#x2013;<lpage>2388</lpage>. <pub-id pub-id-type="doi">10.1016/j.jmb.2017.10.018</pub-id>
</citation>
</ref>
<ref id="B109">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Mishra</surname>
<given-names>P. M.</given-names>
</name>
<name>
<surname>Verma</surname>
<given-names>N. C.</given-names>
</name>
<name>
<surname>Rao</surname>
<given-names>C.</given-names>
</name>
<name>
<surname>Uversky</surname>
<given-names>V. N.</given-names>
</name>
<name>
<surname>Nandi</surname>
<given-names>C. K.</given-names>
</name>
</person-group> (<year>2020</year>). <article-title>Intrinsically disordered proteins of viruses: involvement in the mechanism of cell regulation and pathogenesis</article-title>. <volume>174</volume>, <fpage>1</fpage>&#x2013;<lpage>78</lpage>. <pub-id pub-id-type="doi">10.1016/bs.pmbts.2020.03.001</pub-id>
<source>Prog. Mol. Biol. Transl. Sci.</source>
</citation>
</ref>
<ref id="B110">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Miyamoto</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Itoh</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Suzuki</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>Tanaka</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>Sakai</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Koido</surname>
<given-names>M.</given-names>
</name>
<etal/>
</person-group> (<year>2022</year>). <article-title>SARS-CoV-2 ORF6 disrupts nucleocytoplasmic trafficking to advance viral replication</article-title>. <source>Commun. Biol.</source> <volume>5</volume> (<issue>1</issue>), <fpage>483</fpage>. <pub-id pub-id-type="doi">10.1038/s42003-022-03427-4</pub-id>
</citation>
</ref>
<ref id="B111">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Mohan</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Oldfield</surname>
<given-names>C. J.</given-names>
</name>
<name>
<surname>Radivojac</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Vacic</surname>
<given-names>V.</given-names>
</name>
<name>
<surname>Cortese</surname>
<given-names>M. S.</given-names>
</name>
<name>
<surname>Dunker</surname>
<given-names>A. K.</given-names>
</name>
<etal/>
</person-group> (<year>2006</year>). <article-title>Analysis of molecular recognition features (MoRFs)</article-title>. <source>J. Mol. Biol.</source> <volume>362</volume> (<issue>5</issue>), <fpage>1043</fpage>&#x2013;<lpage>1059</lpage>. <pub-id pub-id-type="doi">10.1016/j.jmb.2006.07.087</pub-id>
</citation>
</ref>
<ref id="B112">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Moosa</surname>
<given-names>M. M.</given-names>
</name>
<name>
<surname>Banerjee</surname>
<given-names>P. R.</given-names>
</name>
</person-group> (<year>2020</year>). <article-title>Subversion of host stress granules by coronaviruses: potential roles of &#x3c0;&#x2010;rich disordered domains of viral nucleocapsids</article-title>. <source>J. Med. Virol.</source> <volume>92</volume> (<issue>12</issue>), <fpage>2891</fpage>&#x2013;<lpage>2893</lpage>. <pub-id pub-id-type="doi">10.1002/jmv.26195</pub-id>
</citation>
</ref>
<ref id="B113">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Morse</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Sefcikova</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Rouzina</surname>
<given-names>I.</given-names>
</name>
<name>
<surname>Beuning</surname>
<given-names>P. J.</given-names>
</name>
<name>
<surname>Williams Mark</surname>
<given-names>C.</given-names>
</name>
</person-group> (<year>2023</year>). <article-title>Structural domains of SARS-CoV-2 nucleocapsid protein coordinate to compact long nucleic acid substrates</article-title>. <source>Nucleic Acids Res.</source> <volume>51</volume> (<issue>1</issue>), <fpage>290</fpage>&#x2013;<lpage>303</lpage>. <pub-id pub-id-type="doi">10.1093/nar/gkac1179</pub-id>
</citation>
</ref>
<ref id="B114">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Mukherjee</surname>
<given-names>S. K.</given-names>
</name>
<name>
<surname>Knop</surname>
<given-names>J. M.</given-names>
</name>
<name>
<surname>Winter</surname>
<given-names>R.</given-names>
</name>
</person-group> (<year>2022</year>). <article-title>Modulation of the conformational space of SARS&#x2010;CoV&#x2010;2 RNA quadruplex rg&#x2010;1 by cellular components and the amyloidogenic peptides &#x3b1;&#x2010;synuclein and hIAPP</article-title>. <source>Chem. A Eur. J.</source> <volume>28</volume> (<issue>9</issue>), <fpage>e202104182</fpage>. <pub-id pub-id-type="doi">10.1002/chem.202104182</pub-id>
</citation>
</ref>
<ref id="B115">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Nakagawa</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Lokugamage</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Makino</surname>
<given-names>S.</given-names>
</name>
</person-group> (<year>2016</year>). <article-title>Viral and cellular mRNA translation in coronavirus-infected cells</article-title>. <source>Adv. Virus Res.</source> <volume>96</volume>, <fpage>165</fpage>&#x2013;<lpage>192</lpage>. <pub-id pub-id-type="doi">10.1016/bs.aivir.2016.08.001</pub-id>
</citation>
</ref>
<ref id="B116">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Nelson</surname>
<given-names>G. W.</given-names>
</name>
<name>
<surname>Stohlman</surname>
<given-names>S. A.</given-names>
</name>
</person-group> (<year>1993</year>). <article-title>Localization of the RNA-binding domain of mouse hepatitis virus nucleocapsid protein</article-title>. <source>J. General Virol.</source> <volume>74</volume> (<issue>9</issue>), <fpage>1975</fpage>&#x2013;<lpage>1979</lpage>. <pub-id pub-id-type="doi">10.1099/0022-1317-74-9-1975</pub-id>
</citation>
</ref>
<ref id="B117">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Nguyen</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Zhao</surname>
<given-names>H.</given-names>
</name>
<name>
<surname>Myagmarsuren</surname>
<given-names>D.</given-names>
</name>
<name>
<surname>Srinivasan</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Wu</surname>
<given-names>D.</given-names>
</name>
<name>
<surname>Chen</surname>
<given-names>J.</given-names>
</name>
<etal/>
</person-group> (<year>2024</year>). <article-title>Modulation of biophysical properties of nucleocapsid protein in the mutant spectrum of SARS-CoV-2</article-title>. <source>eLife</source> <volume>13</volume>. <pub-id pub-id-type="doi">10.7554/elife.94836</pub-id>
</citation>
</ref>
<ref id="B118">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Niklas</surname>
<given-names>K. J.</given-names>
</name>
<name>
<surname>Bondos</surname>
<given-names>S. E.</given-names>
</name>
<name>
<surname>Dunker</surname>
<given-names>A. K.</given-names>
</name>
<name>
<surname>Newman</surname>
<given-names>S. A.</given-names>
</name>
</person-group> (<year>2015</year>). <article-title>Rethinking gene regulatory networks in light of alternative splicing, intrinsically disordered protein domains, and post-translational modifications</article-title>. <source>Front. Cell Dev. Biol.</source> <volume>3</volume>, <fpage>8</fpage>. <pub-id pub-id-type="doi">10.3389/fcell.2015.00008</pub-id>
</citation>
</ref>
<ref id="B119">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Ortiz</surname>
<given-names>J. F.</given-names>
</name>
<name>
<surname>MacDonald</surname>
<given-names>M. L.</given-names>
</name>
<name>
<surname>Masterson</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Uversky</surname>
<given-names>V. N.</given-names>
</name>
<name>
<surname>Siltberg-Liberles</surname>
<given-names>J.</given-names>
</name>
</person-group> (<year>2013</year>). <article-title>Rapid evolutionary dynamics of structural disorder as a potential driving force for biological divergence in flaviviruses</article-title>. <source>Genome Biol. Evol.</source> <volume>5</volume> (<issue>3</issue>), <fpage>504</fpage>&#x2013;<lpage>513</lpage>. <pub-id pub-id-type="doi">10.1093/gbe/evt026</pub-id>
</citation>
</ref>
<ref id="B120">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Peng</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Radivojac</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Vucetic</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Dunker</surname>
<given-names>A. K.</given-names>
</name>
<name>
<surname>Obradovic</surname>
<given-names>Z.</given-names>
</name>
</person-group> (<year>2006</year>). <article-title>Length-dependent prediction of protein intrinsic disorder</article-title>. <source>BMC Bioinforma.</source> <volume>7</volume>, <fpage>208</fpage>&#x2013;<lpage>217</lpage>. <pub-id pub-id-type="doi">10.1186/1471-2105-7-208</pub-id>
</citation>
</ref>
<ref id="B121">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Peng</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Vucetic</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Radivojac</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Brown</surname>
<given-names>C. J.</given-names>
</name>
<name>
<surname>Dunker</surname>
<given-names>A. K.</given-names>
</name>
<name>
<surname>Obradovic</surname>
<given-names>Z.</given-names>
</name>
</person-group> (<year>2005</year>). <article-title>Optimizing long intrinsic disorder predictors with protein evolutionary information</article-title>. <source>J. Bioinforma. Comput. Biol.</source> <volume>3</volume> (<issue>01</issue>), <fpage>35</fpage>&#x2013;<lpage>60</lpage>. <pub-id pub-id-type="doi">10.1142/s0219720005000886</pub-id>
</citation>
</ref>
<ref id="B122">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Peng</surname>
<given-names>T.-Y.</given-names>
</name>
<name>
<surname>Lee</surname>
<given-names>K.-R.</given-names>
</name>
<name>
<surname>Tarn</surname>
<given-names>W.-Y.</given-names>
</name>
</person-group> (<year>2008</year>). <article-title>Phosphorylation of the arginine/serine dipeptide-rich motif of the severe acute respiratory syndrome coronavirus nucleocapsid protein modulates its multimerization, translation inhibitory activity and cellular localization: phosphorylation of SARS CoV-N protein RS motif</article-title>. <source>FEBS J.</source> <volume>275</volume> (<issue>16</issue>), <fpage>4152</fpage>&#x2013;<lpage>4163</lpage>. <pub-id pub-id-type="doi">10.1111/j.1742-4658.2008.06564.x</pub-id>
</citation>
</ref>
<ref id="B123">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Peng</surname>
<given-names>Z.</given-names>
</name>
<name>
<surname>Yan</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Fan</surname>
<given-names>X.</given-names>
</name>
<name>
<surname>Mizianty</surname>
<given-names>M. J.</given-names>
</name>
<name>
<surname>Xue</surname>
<given-names>B.</given-names>
</name>
<name>
<surname>Wang</surname>
<given-names>K.</given-names>
</name>
<etal/>
</person-group> (<year>2015</year>). <article-title>Exceptionally abundant exceptions: comprehensive characterization of intrinsic disorder in all domains of life</article-title>. <source>Cell Mol. Life Sci.</source> <volume>72</volume> (<issue>1</issue>), <fpage>137</fpage>&#x2013;<lpage>151</lpage>. <pub-id pub-id-type="doi">10.1007/s00018-014-1661-9</pub-id>
</citation>
</ref>
<ref id="B124">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Perdikari</surname>
<given-names>T. M.</given-names>
</name>
<name>
<surname>Murthy</surname>
<given-names>A. C.</given-names>
</name>
<name>
<surname>Ryan</surname>
<given-names>V. H.</given-names>
</name>
<name>
<surname>Watters</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Naik</surname>
<given-names>M. T.</given-names>
</name>
<name>
<surname>Fawzi</surname>
<given-names>N. L.</given-names>
</name>
</person-group> (<year>2020</year>). <article-title>SARS&#x2010;CoV&#x2010;2 nucleocapsid protein phase&#x2010;separates with RNA and with human hnRNPs</article-title>. <source>EMBO J.</source> <volume>39</volume> (<issue>24</issue>), <fpage>e106478</fpage>. <pub-id pub-id-type="doi">10.15252/embj.2020106478</pub-id>
</citation>
</ref>
<ref id="B125">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Podder</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Ghosh</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Ghosh</surname>
<given-names>T.</given-names>
</name>
</person-group> (<year>2021</year>). <article-title>Mutations in membrane&#x2010;fusion subunit of spike glycoprotein play crucial role in the recent outbreak of COVID&#x2010;19</article-title>. <source>J. Med. Virol.</source> <volume>93</volume> (<issue>5</issue>), <fpage>2790</fpage>&#x2013;<lpage>2798</lpage>. <pub-id pub-id-type="doi">10.1002/jmv.26598</pub-id>
</citation>
</ref>
<ref id="B126">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Quaglia</surname>
<given-names>F.</given-names>
</name>
<name>
<surname>Salladini</surname>
<given-names>E.</given-names>
</name>
<name>
<surname>Carraro</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Minervini</surname>
<given-names>G.</given-names>
</name>
<name>
<surname>Tosatto</surname>
<given-names>S. C. E.</given-names>
</name>
<name>
<surname>Le Mercier</surname>
<given-names>P.</given-names>
</name>
</person-group> (<year>2022</year>). <article-title>SARS&#x2010;CoV&#x2010;2 variants preferentially emerge at intrinsically disordered protein sites helping immune evasion</article-title>. <source>FEBS J.</source> <volume>289</volume> (<issue>14</issue>), <fpage>4240</fpage>&#x2013;<lpage>4250</lpage>. <pub-id pub-id-type="doi">10.1111/febs.16379</pub-id>
</citation>
</ref>
<ref id="B127">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Rahman</surname>
<given-names>M. S.</given-names>
</name>
<name>
<surname>Islam</surname>
<given-names>M. R.</given-names>
</name>
<name>
<surname>Alam</surname>
<given-names>A. R. U.</given-names>
</name>
<name>
<surname>Islam</surname>
<given-names>I.</given-names>
</name>
<name>
<surname>Hoque</surname>
<given-names>M. N.</given-names>
</name>
<name>
<surname>Akter</surname>
<given-names>S.</given-names>
</name>
<etal/>
</person-group> (<year>2021</year>). <article-title>Evolutionary dynamics of SARS&#x2010;CoV&#x2010;2 nucleocapsid protein and its consequences</article-title>. <source>J. Med. Virol.</source> <volume>93</volume> (<issue>4</issue>), <fpage>2177</fpage>&#x2013;<lpage>2195</lpage>. <pub-id pub-id-type="doi">10.1002/jmv.26626</pub-id>
</citation>
</ref>
<ref id="B128">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Rajagopalan</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Mooney</surname>
<given-names>S. M.</given-names>
</name>
<name>
<surname>Parekh</surname>
<given-names>N.</given-names>
</name>
<name>
<surname>Getzenberg</surname>
<given-names>R. H.</given-names>
</name>
<name>
<surname>Kulkarni</surname>
<given-names>P.</given-names>
</name>
</person-group> (<year>2011</year>). <article-title>A majority of the cancer/testis antigens are intrinsically disordered proteins</article-title>. <source>J. Cell. Biochem.</source> <volume>112</volume> (<issue>11</issue>), <fpage>3256</fpage>&#x2013;<lpage>3267</lpage>. <pub-id pub-id-type="doi">10.1002/jcb.23252</pub-id>
</citation>
</ref>
<ref id="B129">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Ranjan</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Neha</surname>
<given-names>D. C.</given-names>
</name>
<name>
<surname>Devar</surname>
<given-names>K. A.</given-names>
</name>
<name>
<surname>Das</surname>
<given-names>P.</given-names>
</name>
</person-group> (<year>2022</year>). <article-title>The influence of new SARS-CoV-2 variant Omicron (B.1.1.529) on vaccine efficacy, its correlation to delta variants: a computational approach</article-title>. <source>Microb. Pathog.</source> <volume>169</volume>, <fpage>105619</fpage>. <pub-id pub-id-type="doi">10.1016/j.micpath.2022.105619</pub-id>
</citation>
</ref>
<ref id="B130">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Redwan</surname>
<given-names>E. M.</given-names>
</name>
<name>
<surname>AlJaddawi</surname>
<given-names>A. A.</given-names>
</name>
<name>
<surname>Uversky</surname>
<given-names>V. N.</given-names>
</name>
</person-group> (<year>2019</year>). <article-title>Structural disorder in the proteome and interactome of Alkhurma virus (ALKV)</article-title>. <source>Cell Mol. Life Sci.</source> <volume>76</volume>, <fpage>577</fpage>&#x2013;<lpage>608</lpage>. <pub-id pub-id-type="doi">10.1007/s00018-018-2968-8</pub-id>
</citation>
</ref>
<ref id="B131">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Rezaei</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Pereira</surname>
<given-names>F.</given-names>
</name>
<name>
<surname>Uversky</surname>
<given-names>V. N.</given-names>
</name>
<name>
<surname>Sefidbakht</surname>
<given-names>Y.</given-names>
</name>
</person-group> (<year>2022</year>). <article-title>Molecular dynamics and intrinsic disorder analysis of the SARS-CoV-2 Nsp1 structural changes caused by substitution and deletion mutations</article-title>. <source>Mol. Simul.</source> <volume>48</volume> (<issue>13</issue>), <fpage>1192</fpage>&#x2013;<lpage>1201</lpage>. <pub-id pub-id-type="doi">10.1080/08927022.2022.2075546</pub-id>
</citation>
</ref>
<ref id="B132">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Ribeiro-Filho</surname>
<given-names>H. V.</given-names>
</name>
<name>
<surname>Jara</surname>
<given-names>G. E.</given-names>
</name>
<name>
<surname>Batista</surname>
<given-names>F. A. H.</given-names>
</name>
<name>
<surname>Schleder</surname>
<given-names>G. R.</given-names>
</name>
<name>
<surname>Costa Tonoli</surname>
<given-names>C. C.</given-names>
</name>
<name>
<surname>Soprano</surname>
<given-names>A. S.</given-names>
</name>
<etal/>
</person-group> (<year>2022</year>). <article-title>Structural dynamics of SARS-CoV-2 nucleocapsid protein induced by RNA binding</article-title>. <source>PLoS Comput. Biol.</source> <volume>18</volume> (<issue>5</issue>), <fpage>e1010121</fpage>. <pub-id pub-id-type="doi">10.1371/journal.pcbi.1010121</pub-id>
</citation>
</ref>
<ref id="B133">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Romero</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Obradovic</surname>
<given-names>Z.</given-names>
</name>
<name>
<surname>Li</surname>
<given-names>X.</given-names>
</name>
<name>
<surname>Garner</surname>
<given-names>E. C.</given-names>
</name>
<name>
<surname>Brown</surname>
<given-names>C. J.</given-names>
</name>
<name>
<surname>Dunker</surname>
<given-names>A. K.</given-names>
</name>
</person-group> (<year>2001</year>). <article-title>Sequence complexity of disordered protein</article-title>. <source>Proteins Struct. Funct. Bioinforma.</source> <volume>42</volume> (<issue>1</issue>), <fpage>38</fpage>&#x2013;<lpage>48</lpage>. <pub-id pub-id-type="doi">10.1002/1097-0134(20010101)42:1&#x3c;38::aid-prot50&#x3e;3.0.co;2-3</pub-id>
</citation>
</ref>
<ref id="B134">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>R&#xf3;&#x17c;ycki</surname>
<given-names>B.</given-names>
</name>
<name>
<surname>Boura</surname>
<given-names>E.</given-names>
</name>
</person-group> (<year>2022</year>). <article-title>Conformational ensemble of the full-length SARS-CoV-2 nucleocapsid (N) protein based on molecular simulations and SAXS data</article-title>. <source>Biophys. Chem.</source> <volume>288</volume>, <fpage>106843</fpage>. <pub-id pub-id-type="doi">10.1016/j.bpc.2022.106843</pub-id>
</citation>
</ref>
<ref id="B135">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Sakuraba</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Xie</surname>
<given-names>Q.</given-names>
</name>
<name>
<surname>Kasahara</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Iwakiri</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Kono</surname>
<given-names>H.</given-names>
</name>
</person-group> (<year>2022</year>). <article-title>Extended ensemble simulations of a SARS-CoV-2 nsp1&#x2013;5&#x2019;-UTR complex</article-title>. <source>PLoS Comput. Biol.</source> <volume>18</volume> (<issue>1</issue>), <fpage>e1009804</fpage>. <pub-id pub-id-type="doi">10.1371/journal.pcbi.1009804</pub-id>
</citation>
</ref>
<ref id="B136">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Savastano</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Ib&#xe1;&#xf1;ez de Opakua</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Rankovic</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Zweckstetter</surname>
<given-names>M.</given-names>
</name>
</person-group> (<year>2020</year>). <article-title>Nucleocapsid protein of SARS-CoV-2 phase separates into RNA-rich polymerase-containing condensates</article-title>. <source>Nat. Commun.</source> <volume>11</volume> (<issue>1</issue>), <fpage>6041</fpage>. <pub-id pub-id-type="doi">10.1038/s41467-020-19843-1</pub-id>
</citation>
</ref>
<ref id="B137">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Schiavina</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Pontoriero</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Tagliaferro</surname>
<given-names>G.</given-names>
</name>
<name>
<surname>Pierattelli</surname>
<given-names>R.</given-names>
</name>
<name>
<surname>Felli</surname>
<given-names>I. C.</given-names>
</name>
</person-group> (<year>2022</year>). <article-title>The role of disordered regions in orchestrating the properties of multidomain proteins: the SARS-CoV-2 nucleocapsid protein and its interaction with Enoxaparin</article-title>. <source>Biomolecules</source> <volume>12</volume> (<issue>9</issue>), <fpage>1302</fpage>. <pub-id pub-id-type="doi">10.3390/biom12091302</pub-id>
</citation>
</ref>
<ref id="B138">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Schubert</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Karousis</surname>
<given-names>E. D.</given-names>
</name>
<name>
<surname>Jomaa</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Scaiola</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Echeverria</surname>
<given-names>B.</given-names>
</name>
<name>
<surname>Gurzeler</surname>
<given-names>L.-A.</given-names>
</name>
<etal/>
</person-group> (<year>2020</year>). <article-title>SARS-CoV-2 Nsp1 binds the ribosomal mRNA channel to inhibit translation</article-title>. <source>Nat. Struct. Mol. Biol.</source> <volume>27</volume> (<issue>10</issue>), <fpage>959</fpage>&#x2013;<lpage>966</lpage>. <pub-id pub-id-type="doi">10.1038/s41594-020-0511-8</pub-id>
</citation>
</ref>
<ref id="B139">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Sekine</surname>
<given-names>R.</given-names>
</name>
<name>
<surname>Tsuno</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Irokawa</surname>
<given-names>H.</given-names>
</name>
<name>
<surname>Sumitomo</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Han</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>Sato</surname>
<given-names>Y.</given-names>
</name>
<etal/>
</person-group> (<year>2023</year>). <article-title>Inhibition of SARS-CoV-2 nucleocapsid protein&#x2013;RNA interaction by guanosine oligomeric RNA</article-title>. <source>J. Biochem.</source> <volume>173</volume> (<issue>6</issue>), <fpage>447</fpage>&#x2013;<lpage>457</lpage>. <pub-id pub-id-type="doi">10.1093/jb/mvad008</pub-id>
</citation>
</ref>
<ref id="B140">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Semper</surname>
<given-names>C.</given-names>
</name>
<name>
<surname>Watanabe</surname>
<given-names>N.</given-names>
</name>
<name>
<surname>Savchenko</surname>
<given-names>A.</given-names>
</name>
</person-group> (<year>2021</year>). <article-title>Structural characterization of nonstructural protein 1 from SARS-CoV-2</article-title>. <source>iScience</source> <volume>24</volume> (<issue>1</issue>), <fpage>101903</fpage>. <pub-id pub-id-type="doi">10.1016/j.isci.2020.101903</pub-id>
</citation>
</ref>
<ref id="B142">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Sinha</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Roy</surname>
<given-names>S.</given-names>
</name>
</person-group> (<year>2023</year>). <article-title>Intrinsically disordered regions function as a cervical collar to remotely regulate the nodding dynamics of SARS-CoV-2 prefusion spike heads</article-title>. <source>J. Phys. Chem. B</source> <volume>127</volume> (<issue>39</issue>), <fpage>8393</fpage>&#x2013;<lpage>8405</lpage>. <pub-id pub-id-type="doi">10.1021/acs.jpcb.3c05338</pub-id>
</citation>
</ref>
<ref id="B143">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Spreitzer</surname>
<given-names>E.</given-names>
</name>
<name>
<surname>Usluer</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Madl</surname>
<given-names>T.</given-names>
</name>
</person-group> (<year>2020</year>). <article-title>Probing surfaces in dynamic protein interactions</article-title>. <source>J. Mol. Biol.</source> <volume>432</volume> (<issue>9</issue>), <fpage>2949</fpage>&#x2013;<lpage>2972</lpage>. <pub-id pub-id-type="doi">10.1016/j.jmb.2020.02.032</pub-id>
</citation>
</ref>
<ref id="B144">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Syed</surname>
<given-names>A. M.</given-names>
</name>
<name>
<surname>Taha</surname>
<given-names>T. Y.</given-names>
</name>
<name>
<surname>Tabata</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>Chen</surname>
<given-names>I. P.</given-names>
</name>
<name>
<surname>Ciling</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Khalid</surname>
<given-names>M. M.</given-names>
</name>
<etal/>
</person-group> (<year>2021</year>). <article-title>Rapid assessment of SARS-CoV-2&#x2013;evolved variants using virus-like particles</article-title>. <source>Sci. (New York, NY)</source> <volume>374</volume> (<issue>6575</issue>), <fpage>1626</fpage>&#x2013;<lpage>1632</lpage>. <pub-id pub-id-type="doi">10.1126/science.abl6184</pub-id>
</citation>
</ref>
<ref id="B145">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Tanaka</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>Kamitani</surname>
<given-names>W.</given-names>
</name>
<name>
<surname>DeDiego</surname>
<given-names>M. L.</given-names>
</name>
<name>
<surname>Enjuanes</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Matsuura</surname>
<given-names>Y.</given-names>
</name>
</person-group> (<year>2012</year>). <article-title>Severe acute respiratory syndrome coronavirus nsp1 facilitates efficient propagation in cells through a specific translational shutoff of host mRNA</article-title>. <source>J. Virol.</source> <volume>86</volume> (<issue>20</issue>), <fpage>11128</fpage>&#x2013;<lpage>11137</lpage>. <pub-id pub-id-type="doi">10.1128/jvi.01700-12</pub-id>
</citation>
</ref>
<ref id="B146">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Taneja</surname>
<given-names>I.</given-names>
</name>
<name>
<surname>Holehouse</surname>
<given-names>A. S.</given-names>
</name>
</person-group> (<year>2021</year>). <article-title>Folded domain charge properties influence the conformational behavior of disordered tails</article-title>. <source>Curr. Res. Struct. Biol.</source> <volume>3</volume>, <fpage>216</fpage>&#x2013;<lpage>228</lpage>. <pub-id pub-id-type="doi">10.1016/j.crstbi.2021.08.002</pub-id>
</citation>
</ref>
<ref id="B147">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Terada</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Kawachi</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Matsuura</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Kamitani</surname>
<given-names>W.</given-names>
</name>
</person-group> (<year>2017</year>). <article-title>MERS coronavirus nsp1 participates in an efficient propagation through a specific interaction with viral RNA</article-title>. <source>Virol.</source> <volume>511</volume>, <fpage>95</fpage>&#x2013;<lpage>105</lpage>. <pub-id pub-id-type="doi">10.1016/j.virol.2017.08.026</pub-id>
</citation>
</ref>
<ref id="B148">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Thoms</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Buschauer</surname>
<given-names>R.</given-names>
</name>
<name>
<surname>Ameismeier</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Koepke</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Denk</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>Hirschenberger</surname>
<given-names>M.</given-names>
</name>
<etal/>
</person-group> (<year>2020</year>). <article-title>Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2</article-title>. <source>Sci. (1979).</source> <volume>369</volume>, <fpage>1249</fpage>&#x2013;<lpage>1255</lpage>. <pub-id pub-id-type="doi">10.1126/science.abc8665</pub-id>
</citation>
</ref>
<ref id="B149">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Tidu</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Janvier</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Schaeffer</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Sosnowski</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Kuhn</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Hammann</surname>
<given-names>P.</given-names>
</name>
<etal/>
</person-group> (<year>2021</year>). <article-title>The viral protein NSP1 acts as a ribosome gatekeeper for shutting down host translation and fostering SARS-CoV-2 translation</article-title>. <source>Rna</source> <volume>27</volume> (<issue>3</issue>), <fpage>253</fpage>&#x2013;<lpage>264</lpage>. <pub-id pub-id-type="doi">10.1261/rna.078121.120</pub-id>
</citation>
</ref>
<ref id="B150">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Tomaszewski</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>DeVries</surname>
<given-names>R. S.</given-names>
</name>
<name>
<surname>Dong</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Bhatia</surname>
<given-names>G.</given-names>
</name>
<name>
<surname>Norsworthy</surname>
<given-names>M. D.</given-names>
</name>
<name>
<surname>Zheng</surname>
<given-names>X.</given-names>
</name>
<etal/>
</person-group> (<year>2020</year>). <article-title>New pathways of mutational change in SARS-CoV-2 proteomes involve regions of intrinsic disorder important for virus replication and release</article-title>. <source>Evol. Bioinforma.</source> <volume>16</volume>, <fpage>1176934320965149</fpage>. <pub-id pub-id-type="doi">10.1177/1176934320965149</pub-id>
</citation>
</ref>
<ref id="B151">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Tompa</surname>
<given-names>P.</given-names>
</name>
</person-group> (<year>2002</year>). <article-title>Intrinsically unstructured proteins</article-title>. <source>Trends biochem. Sci.</source> <volume>27</volume>, <fpage>527</fpage>&#x2013;<lpage>533</lpage>. <pub-id pub-id-type="doi">10.1016/s0968-0004(02)02169-2</pub-id>
</citation>
</ref>
<ref id="B152">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Tugaeva</surname>
<given-names>K. V.</given-names>
</name>
<name>
<surname>Hawkins</surname>
<given-names>D. E.</given-names>
</name>
<name>
<surname>Smith</surname>
<given-names>J. L.</given-names>
</name>
<name>
<surname>Bayfield</surname>
<given-names>O. W.</given-names>
</name>
<name>
<surname>Ker</surname>
<given-names>D.-S.</given-names>
</name>
<name>
<surname>Sysoev</surname>
<given-names>A. A.</given-names>
</name>
<etal/>
</person-group> (<year>2021</year>). <article-title>The mechanism of SARS-CoV-2 nucleocapsid protein recognition by the human 14-3-3 proteins</article-title>. <source>J. Mol. Biol.</source> <volume>433</volume> (<issue>8</issue>), <fpage>166875</fpage>. <pub-id pub-id-type="doi">10.1016/j.jmb.2021.166875</pub-id>
</citation>
</ref>
<ref id="B153">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Tugaeva</surname>
<given-names>K. V.</given-names>
</name>
<name>
<surname>Sysoev</surname>
<given-names>A. A.</given-names>
</name>
<name>
<surname>Kapitonova</surname>
<given-names>A. A.</given-names>
</name>
<name>
<surname>Smith</surname>
<given-names>J. L. R.</given-names>
</name>
<name>
<surname>Zhu</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Cooley</surname>
<given-names>R. B.</given-names>
</name>
<etal/>
</person-group> (<year>2023</year>). <article-title>Human 14-3-3 proteins site-selectively bind the mutational hotspot region of SARS-CoV-2 nucleoprotein modulating its phosphoregulation</article-title>. <source>J. Mol. Biol.</source> <volume>435</volume> (<issue>2</issue>), <fpage>167891</fpage>. <pub-id pub-id-type="doi">10.1016/j.jmb.2022.167891</pub-id>
</citation>
</ref>
<ref id="B154">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Vankadari</surname>
<given-names>N.</given-names>
</name>
<name>
<surname>Jeyasankar</surname>
<given-names>N. N.</given-names>
</name>
<name>
<surname>Lopes</surname>
<given-names>W. J.</given-names>
</name>
</person-group> (<year>2020</year>). <article-title>Structure of the SARS-CoV-2 Nsp1/5&#x2032;-untranslated region complex and implications for potential therapeutic targets, a vaccine, and virulence</article-title>. <source>J. Phys. Chem. Lett.</source> <volume>11</volume> (<issue>22</issue>), <fpage>9659</fpage>&#x2013;<lpage>9668</lpage>. <pub-id pub-id-type="doi">10.1021/acs.jpclett.0c02818</pub-id>
</citation>
</ref>
<ref id="B155">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Van Roey</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Dinkel</surname>
<given-names>H.</given-names>
</name>
<name>
<surname>Weatheritt</surname>
<given-names>R. J.</given-names>
</name>
<name>
<surname>Gibson</surname>
<given-names>T. J.</given-names>
</name>
<name>
<surname>Davey</surname>
<given-names>N. E.</given-names>
</name>
</person-group> (<year>2013</year>). <article-title>The switches. ELM resource: a compendium of conditional regulatory interaction interfaces</article-title>. <source>Sci. Signal.</source> <volume>6</volume> (<issue>269</issue>), <fpage>rs7</fpage>&#x2013;<lpage>rs</lpage>. <pub-id pub-id-type="doi">10.1126/scisignal.2003345</pub-id>
</citation>
</ref>
<ref id="B156">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Van Roey</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Gibson</surname>
<given-names>T. J.</given-names>
</name>
<name>
<surname>Davey</surname>
<given-names>N. E.</given-names>
</name>
</person-group> (<year>2012</year>). <article-title>Motif switches: decision-making in cell regulation</article-title>. <source>Curr. Opin. Struct. Biol.</source> <volume>22</volume> (<issue>3</issue>), <fpage>378</fpage>&#x2013;<lpage>385</lpage>. <pub-id pub-id-type="doi">10.1016/j.sbi.2012.03.004</pub-id>
</citation>
</ref>
<ref id="B157">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Venkatesan</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Rual</surname>
<given-names>J.-F.</given-names>
</name>
<name>
<surname>Vazquez</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Stelzl</surname>
<given-names>U.</given-names>
</name>
<name>
<surname>Lemmens</surname>
<given-names>I.</given-names>
</name>
<name>
<surname>Hirozane-Kishikawa</surname>
<given-names>T.</given-names>
</name>
<etal/>
</person-group> (<year>2009</year>). <article-title>An empirical framework for binary interactome mapping</article-title>. <source>Nat. Methods</source> <volume>6</volume> (<issue>1</issue>), <fpage>83</fpage>&#x2013;<lpage>90</lpage>. <pub-id pub-id-type="doi">10.1038/nmeth.1280</pub-id>
</citation>
</ref>
<ref id="B158">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Verma</surname>
<given-names>G.</given-names>
</name>
<name>
<surname>Singh</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Bhat</surname>
<given-names>R.</given-names>
</name>
</person-group> (<year>2020</year>). <article-title>Disorder under stress: role of polyol osmolytes in modulating fibrillation and aggregation of intrinsically disordered proteins</article-title>. <source>Biophys. Chem.</source> <volume>264</volume>, <fpage>106422</fpage>. <pub-id pub-id-type="doi">10.1016/j.bpc.2020.106422</pub-id>
</citation>
</ref>
<ref id="B159">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>V&#x2019;kovski</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Kratzel</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Steiner</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Stalder</surname>
<given-names>H.</given-names>
</name>
<name>
<surname>Thiel</surname>
<given-names>V.</given-names>
</name>
</person-group> (<year>2021</year>). <article-title>Coronavirus biology and replication: implications for SARS-CoV-2</article-title>. <source>Nat. Rev. Microbiol.</source> <volume>19</volume> (<issue>3</issue>), <fpage>155</fpage>&#x2013;<lpage>170</lpage>. <pub-id pub-id-type="doi">10.1038/s41579-020-00468-6</pub-id>
</citation>
</ref>
<ref id="B160">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Vora</surname>
<given-names>S. M.</given-names>
</name>
<name>
<surname>Fontana</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Mao</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>Leger</surname>
<given-names>V.</given-names>
</name>
<name>
<surname>Zhang</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Fu</surname>
<given-names>T.-M.</given-names>
</name>
<etal/>
</person-group> (<year>2022</year>). <article-title>Targeting stem-loop 1 of the SARS-CoV-2 5&#x2032; UTR to suppress viral translation and Nsp1 evasion</article-title>. <source>Proc. Natl. Acad. Sci. U. S. A.</source> <volume>119</volume> (<issue>9</issue>), <fpage>e2117198119</fpage>. <pub-id pub-id-type="doi">10.1073/pnas.2117198119</pub-id>
</citation>
</ref>
<ref id="B141">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Vora</surname>
<given-names>S. M.</given-names>
</name>
<name>
<surname>Fontana</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Mao</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>Leger</surname>
<given-names>V.</given-names>
</name>
<name>
<surname>Zhang</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Fu</surname>
<given-names>T.</given-names>
</name>
<etal/>
</person-group> (<year>2022</year>). <article-title>Targeting stem-loop 1 of the SARS-CoV-2 5&#x2019; UTR to suppress viral translation and Nsp1 evasion</article-title>. <source>Proc Natl Acad Sci U S A</source>. <volume>119</volume>(<issue>9</issue>):<fpage>e2117198119</fpage>. <pub-id pub-id-type="doi">10.1073/pnas.2117198119</pub-id>
</citation>
</ref>
<ref id="B161">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Wang</surname>
<given-names>C.</given-names>
</name>
<name>
<surname>Zheng</surname>
<given-names>X.</given-names>
</name>
<name>
<surname>Gai</surname>
<given-names>W.</given-names>
</name>
<name>
<surname>Zhao</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Wang</surname>
<given-names>H.</given-names>
</name>
<name>
<surname>Wang</surname>
<given-names>H.</given-names>
</name>
<etal/>
</person-group> (<year>2017</year>). <article-title>MERS-CoV virus-like particles produced in insect cells induce specific humoural and cellular imminity in rhesus macaques</article-title>. <source>Oncotarget</source> <volume>8</volume> (<issue>8</issue>), <fpage>12686</fpage>&#x2013;<lpage>12694</lpage>. <pub-id pub-id-type="doi">10.18632/oncotarget.8475</pub-id>
</citation>
</ref>
<ref id="B162">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Wang</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Shi</surname>
<given-names>C.</given-names>
</name>
<name>
<surname>Xu</surname>
<given-names>Q.</given-names>
</name>
<name>
<surname>Yin</surname>
<given-names>H.</given-names>
</name>
</person-group> (<year>2021b</year>). <article-title>SARS-CoV-2 nucleocapsid protein undergoes liquid&#x2013;liquid phase separation into stress granules through its N-terminal intrinsically disordered region</article-title>. <source>Cell Discov.</source> <volume>7</volume> (<issue>1</issue>), <fpage>5</fpage>. <pub-id pub-id-type="doi">10.1038/s41421-020-00240-3</pub-id>
</citation>
</ref>
<ref id="B163">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Wang</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Kirkpatrick</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Lage</surname>
<given-names>Sz</given-names>
</name>
<name>
<surname>Carlomagno</surname>
<given-names>T.</given-names>
</name>
</person-group> (<year>2023</year>). <article-title>Structural insights into the activity regulation of full-length non-structural protein 1 from SARS-CoV-2</article-title>. <source>Structure</source> <volume>31</volume> (<issue>2</issue>), <fpage>128</fpage>&#x2013;<lpage>37.e5</lpage>. <pub-id pub-id-type="doi">10.1016/j.str.2022.12.006</pub-id>
</citation>
</ref>
<ref id="B164">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Wang</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Kirkpatrick</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>zur Lage</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Korn</surname>
<given-names>S. M.</given-names>
</name>
<name>
<surname>Nei&#xdf;ner</surname>
<given-names>K.</given-names>
</name>
<name>
<surname>Schwalbe</surname>
<given-names>H.</given-names>
</name>
<etal/>
</person-group> (<year>2021a</year>). <article-title>1H, 13C, and 15N backbone chemical-shift assignments of SARS-CoV-2 non-structural protein 1 (leader protein)</article-title>. <source>Biomol. NMR Assignments</source> <volume>15</volume> (<issue>2</issue>), <fpage>287</fpage>&#x2013;<lpage>295</lpage>. <pub-id pub-id-type="doi">10.1007/s12104-021-10019-6</pub-id>
</citation>
</ref>
<ref id="B165">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>White</surname>
<given-names>T. C.</given-names>
</name>
<name>
<surname>Yi</surname>
<given-names>Z.</given-names>
</name>
<name>
<surname>Hogue</surname>
<given-names>B. G.</given-names>
</name>
</person-group> (<year>2007</year>). <article-title>Identification of mouse hepatitis coronavirus A59 nucleocapsid protein phosphorylation sites</article-title>. <source>Virus Res.</source> <volume>126</volume> (<issue>1-2</issue>), <fpage>139</fpage>&#x2013;<lpage>148</lpage>. <pub-id pub-id-type="doi">10.1016/j.virusres.2007.02.008</pub-id>
</citation>
</ref>
<ref id="B166">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Wohl</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Gilron</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Zheng</surname>
<given-names>W.</given-names>
</name>
</person-group> (<year>2025</year>). <article-title>Structural and functional relevance of charge-based transient interactions inside intrinsically disordered proteins</article-title>. <source>ACS Phys. Chem. Au</source>. <pub-id pub-id-type="doi">10.1021/acsphyschemau.5c00005</pub-id>
</citation>
</ref>
<ref id="B167">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Woo</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Lee</surname>
<given-names>E. Y.</given-names>
</name>
<name>
<surname>Lee</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Kim</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>Cho</surname>
<given-names>Y.-E.</given-names>
</name>
</person-group> (<year>2019</year>). <article-title>An <italic>in vivo</italic> cell-based assay for investigating the specific interaction between the SARS-CoV N-protein and its viral RNA packaging sequence</article-title>. <source>Biochem. Biophys. Res. Commun.</source> <volume>520</volume> (<issue>3</issue>), <fpage>499</fpage>&#x2013;<lpage>506</lpage>. <pub-id pub-id-type="doi">10.1016/j.bbrc.2019.09.115</pub-id>
</citation>
</ref>
<ref id="B168">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Wu</surname>
<given-names>C.</given-names>
</name>
<name>
<surname>Qavi</surname>
<given-names>A. J.</given-names>
</name>
<name>
<surname>Hachim</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Kavian</surname>
<given-names>N.</given-names>
</name>
<name>
<surname>Cole</surname>
<given-names>A. R.</given-names>
</name>
<name>
<surname>Moyle</surname>
<given-names>A. B.</given-names>
</name>
<etal/>
</person-group> (<year>2021</year>). <article-title>Characterization of SARS-CoV-2 nucleocapsid protein reveals multiple functional consequences of the C-terminal domain</article-title>. <source>iScience</source> <volume>24</volume> (<issue>6</issue>), <fpage>102681</fpage>. <pub-id pub-id-type="doi">10.1016/j.isci.2021.102681</pub-id>
</citation>
</ref>
<ref id="B169">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Wu</surname>
<given-names>C.-H.</given-names>
</name>
<name>
<surname>Chen</surname>
<given-names>P.-J.</given-names>
</name>
<name>
<surname>Yeh</surname>
<given-names>S.-H.</given-names>
</name>
</person-group> (<year>2014</year>). <article-title>Nucleocapsid phosphorylation and RNA helicase DDX1 recruitment enables coronavirus transition from discontinuous to continuous transcription</article-title>. <source>Cell Host Microbe</source> <volume>16</volume> (<issue>4</issue>), <fpage>462</fpage>&#x2013;<lpage>472</lpage>. <pub-id pub-id-type="doi">10.1016/j.chom.2014.09.009</pub-id>
</citation>
</ref>
<ref id="B170">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Xue</surname>
<given-names>B.</given-names>
</name>
<name>
<surname>Williams R</surname>
<given-names>W.</given-names>
</name>
<name>
<surname>Oldfield C</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Kian-Meng Goh</surname>
<given-names>G.</given-names>
</name>
<name>
<surname>Keith Dunker</surname>
<given-names>A. N.</given-names>
</name>
<name>
<surname>Uversky</surname>
<given-names>V.</given-names>
</name>
</person-group> (<year>2010</year>). <article-title>Viral disorder or disordered viruses: do viral proteins possess unique features?</article-title> <source>PPL</source> <volume>17</volume> (<issue>8</issue>), <fpage>932</fpage>&#x2013;<lpage>951</lpage>.</citation>
</ref>
<ref id="B171">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Yan</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Dunker</surname>
<given-names>A. K.</given-names>
</name>
<name>
<surname>Uversky</surname>
<given-names>V. N.</given-names>
</name>
<name>
<surname>Kurgan</surname>
<given-names>L.</given-names>
</name>
</person-group> (<year>2016</year>). <article-title>Molecular recognition features (MoRFs) in three domains of life</article-title>. <source>Mol. Biosyst.</source> <volume>12</volume> (<issue>3</issue>), <fpage>697</fpage>&#x2013;<lpage>710</lpage>. <pub-id pub-id-type="doi">10.1039/c5mb00640f</pub-id>
</citation>
</ref>
<ref id="B172">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Yang</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>He</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Chen</surname>
<given-names>X.</given-names>
</name>
<name>
<surname>Huang</surname>
<given-names>Z.</given-names>
</name>
<name>
<surname>Zhou</surname>
<given-names>Z.</given-names>
</name>
<name>
<surname>Zhou</surname>
<given-names>Z.</given-names>
</name>
<etal/>
</person-group> (<year>2021</year>). <article-title>Structural insight into the SARS-CoV-2 nucleocapsid protein C-terminal domain reveals a novel recognition mechanism for viral transcriptional regulatory sequences</article-title>. <source>Front. Chem.</source> <volume>8</volume>, <fpage>624765</fpage>. <pub-id pub-id-type="doi">10.3389/fchem.2020.624765</pub-id>
</citation>
</ref>
<ref id="B173">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Yao</surname>
<given-names>H.</given-names>
</name>
<name>
<surname>Song</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Chen</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Wu</surname>
<given-names>N.</given-names>
</name>
<name>
<surname>Xu</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Sun</surname>
<given-names>C.</given-names>
</name>
<etal/>
</person-group> (<year>2020</year>). <article-title>Molecular architecture of the SARS-CoV-2 virus</article-title>. <source>Cell</source> <volume>183</volume> (<issue>3</issue>), <fpage>730</fpage>&#x2013;<lpage>8. e13</lpage>. <pub-id pub-id-type="doi">10.1016/j.cell.2020.09.018</pub-id>
</citation>
</ref>
<ref id="B174">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Yaron</surname>
<given-names>T. M.</given-names>
</name>
<name>
<surname>Heaton</surname>
<given-names>B. E.</given-names>
</name>
<name>
<surname>Levy</surname>
<given-names>T. M.</given-names>
</name>
<name>
<surname>Johnson</surname>
<given-names>J. L.</given-names>
</name>
<name>
<surname>Jordan</surname>
<given-names>T. X.</given-names>
</name>
<name>
<surname>Cohen</surname>
<given-names>B. M.</given-names>
</name>
<etal/>
</person-group> (<year>2022</year>). <article-title>Host protein kinases required for SARS-CoV-2 nucleocapsid phosphorylation and viral replication</article-title>. <source>Sci. Signal.</source> <volume>15</volume> (<issue>757</issue>), <fpage>eabm0808</fpage>. <pub-id pub-id-type="doi">10.1126/scisignal.abm0808</pub-id>
</citation>
</ref>
<ref id="B175">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Ye</surname>
<given-names>Q.</given-names>
</name>
<name>
<surname>Lu</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Corbett</surname>
<given-names>K. D.</given-names>
</name>
</person-group> (<year>2021</year>). <article-title>Structural basis for SARS-CoV-2 nucleocapsid protein recognition by single-domain antibodies</article-title>. <source>Front. Immunol.</source> <volume>12</volume>, <fpage>719037</fpage>. <pub-id pub-id-type="doi">10.3389/fimmu.2021.719037</pub-id>
</citation>
</ref>
<ref id="B176">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Yesudhas</surname>
<given-names>D.</given-names>
</name>
<name>
<surname>Srivastava</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Sekijima</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Gromiha</surname>
<given-names>M. M.</given-names>
</name>
</person-group> (<year>2021</year>). <article-title>Tackling Covid&#x2010;19 using disordered&#x2010;to&#x2010;order transition of residues in the spike protein upon angiotensin&#x2010;converting enzyme 2 binding</article-title>. <source>Proteins Struct. Funct. Bioinforma.</source> <volume>89</volume> (<issue>9</issue>), <fpage>1158</fpage>&#x2013;<lpage>1166</lpage>. <pub-id pub-id-type="doi">10.1002/prot.26088</pub-id>
</citation>
</ref>
<ref id="B177">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Yu</surname>
<given-names>I.-M.</given-names>
</name>
<name>
<surname>Gustafson</surname>
<given-names>C. L.</given-names>
</name>
<name>
<surname>Diao</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Burgner</surname>
<given-names>J. W.</given-names>
</name>
<name>
<surname>Li</surname>
<given-names>Z.</given-names>
</name>
<name>
<surname>Zhang</surname>
<given-names>J.</given-names>
</name>
<etal/>
</person-group> (<year>2005</year>). <article-title>Recombinant severe acute respiratory syndrome (SARS) coronavirus nucleocapsid protein forms a dimer through its C-terminal domain</article-title>. <source>J. Biol. Chem.</source> <volume>280</volume> (<issue>24</issue>), <fpage>23280</fpage>&#x2013;<lpage>23286</lpage>. <pub-id pub-id-type="doi">10.1074/jbc.m501015200</pub-id>
</citation>
</ref>
<ref id="B178">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Yuan</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Peng</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Park</surname>
<given-names>J. J.</given-names>
</name>
<name>
<surname>Hu</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Devarkar</surname>
<given-names>S. C.</given-names>
</name>
<name>
<surname>Dong</surname>
<given-names>M. B.</given-names>
</name>
<etal/>
</person-group> (<year>2020</year>). <article-title>Nonstructural protein 1 of SARS-CoV-2 is a potent pathogenicity factor redirecting host protein synthesis machinery toward viral RNA</article-title>. <source>Mol. Cell</source> <volume>80</volume> (<issue>6</issue>), <fpage>1055</fpage>&#x2013;<lpage>66. e6</lpage>. <pub-id pub-id-type="doi">10.1016/j.molcel.2020.10.034</pub-id>
</citation>
</ref>
<ref id="B179">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Zachrdla</surname>
<given-names>M.</given-names>
</name>
<name>
<surname>Savastano</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Ib&#xe1;&#xf1;ez de Opakua</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Cima&#x2010;Omori</surname>
<given-names>M. S.</given-names>
</name>
<name>
<surname>Zweckstetter</surname>
<given-names>M.</given-names>
</name>
</person-group> (<year>2022</year>). <article-title>Contributions of the N&#x2010;terminal intrinsically disordered region of the severe acute respiratory syndrome coronavirus 2 nucleocapsid protein to RNA&#x2010;induced phase separation</article-title>. <source>Protein Sci.</source> <volume>31</volume> (<issue>9</issue>), <fpage>e4409</fpage>. <pub-id pub-id-type="doi">10.1002/pro.4409</pub-id>
</citation>
</ref>
<ref id="B180">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Zhang</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Cai</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Xiao</surname>
<given-names>T.</given-names>
</name>
<name>
<surname>Lu</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Peng</surname>
<given-names>H.</given-names>
</name>
<name>
<surname>Sterling</surname>
<given-names>S. M.</given-names>
</name>
<etal/>
</person-group> (<year>2021</year>). <article-title>Structural impact on SARS-CoV-2 spike protein by D614G substitution</article-title>. <source>Sci. (New York, NY)</source> <volume>372</volume> (<issue>6541</issue>), <fpage>525</fpage>&#x2013;<lpage>530</lpage>. <pub-id pub-id-type="doi">10.1126/science.abf2303</pub-id>
</citation>
</ref>
<ref id="B181">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Zhao</surname>
<given-names>D.</given-names>
</name>
<name>
<surname>Xu</surname>
<given-names>W.</given-names>
</name>
<name>
<surname>Zhang</surname>
<given-names>X.</given-names>
</name>
<name>
<surname>Wang</surname>
<given-names>X.</given-names>
</name>
<name>
<surname>Ge</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Yuan</surname>
<given-names>E.</given-names>
</name>
<etal/>
</person-group> (<year>2021</year>). <article-title>Understanding the phase separation characteristics of nucleocapsid protein provides a new therapeutic opportunity against SARS-CoV-2</article-title>. <source>Protein Cell</source> <volume>12</volume> (<issue>9</issue>), <fpage>734</fpage>&#x2013;<lpage>740</lpage>. <pub-id pub-id-type="doi">10.1007/s13238-021-00832-z</pub-id>
</citation>
</ref>
<ref id="B182">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Zhao</surname>
<given-names>H.</given-names>
</name>
<name>
<surname>Nguyen</surname>
<given-names>A.</given-names>
</name>
<name>
<surname>Wu</surname>
<given-names>D.</given-names>
</name>
<name>
<surname>Li</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Hassan</surname>
<given-names>S. A.</given-names>
</name>
<name>
<surname>Chen</surname>
<given-names>J.</given-names>
</name>
<etal/>
</person-group> (<year>2022</year>). <article-title>Plasticity in structure and assembly of SARS-CoV-2 nucleocapsid protein</article-title>. <source>PNAS Nexus</source> <volume>1</volume> (<issue>2</issue>), <fpage>pgac049</fpage>. <pub-id pub-id-type="doi">10.1093/pnasnexus/pgac049</pub-id>
</citation>
</ref>
<ref id="B183">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Zhou</surname>
<given-names>P.</given-names>
</name>
<name>
<surname>Yang</surname>
<given-names>X.-L.</given-names>
</name>
<name>
<surname>Wang</surname>
<given-names>X.-G.</given-names>
</name>
<name>
<surname>Hu</surname>
<given-names>B.</given-names>
</name>
<name>
<surname>Zhang</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Zhang</surname>
<given-names>W.</given-names>
</name>
<etal/>
</person-group> (<year>2020</year>). <article-title>A pneumonia outbreak associated with a new coronavirus of probable bat origin</article-title>. <source>Nature</source> <volume>579</volume> (<issue>7798</issue>), <fpage>270</fpage>&#x2013;<lpage>273</lpage>. <pub-id pub-id-type="doi">10.1038/s41586-020-2012-7</pub-id>
</citation>
</ref>
<ref id="B184">
<citation citation-type="journal">
<person-group person-group-type="author">
<name>
<surname>Zhou</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Liu</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Gupta</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Paramo</surname>
<given-names>M. I.</given-names>
</name>
<name>
<surname>Hou</surname>
<given-names>Y.</given-names>
</name>
<name>
<surname>Mao</surname>
<given-names>C.</given-names>
</name>
<etal/>
</person-group> (<year>2023</year>). <article-title>A comprehensive SARS-CoV-2&#x2013;human protein&#x2013;protein interactome reveals COVID-19 pathobiology and potential host therapeutic targets</article-title>. <source>Nat. Biotechnol.</source> <volume>41</volume> (<issue>1</issue>), <fpage>128</fpage>&#x2013;<lpage>139</lpage>. <pub-id pub-id-type="doi">10.1038/s41587-022-01474-0</pub-id>
</citation>
</ref>
<ref id="B185">
<citation citation-type="book">
<person-group person-group-type="author">
<name>
<surname>Zinzula</surname>
<given-names>L.</given-names>
</name>
<name>
<surname>Basquin</surname>
<given-names>J.</given-names>
</name>
<name>
<surname>Bohn</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Beck</surname>
<given-names>F.</given-names>
</name>
<name>
<surname>Klumpe</surname>
<given-names>S.</given-names>
</name>
<name>
<surname>Pfeifer</surname>
<given-names>G.</given-names>
</name>
<etal/>
</person-group> (<year>2021</year>). <article-title>High-resolution structure and biophysical characterization of the nucleocapsid phosphoprotein dimerization domain from the Covid-19 severe acute respiratory syndrome coronavirus 2</article-title>. <source>Biochemical and biophysical research communications</source>. <volume>538</volume>:<fpage>54</fpage>&#x2013;<lpage>62</lpage>. <pub-id pub-id-type="doi">10.1016/j.bbrc.2020.09.131</pub-id>
</citation>
</ref>
</ref-list>
</back>
</article>